BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|239755869 PREDICTED: hypothetical protein [Homo sapiens] (148 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|239755869 PREDICTED: hypothetical protein [Homo sapiens] 303 3e-83 gi|32261332 seizure related 6 homolog (mouse)-like precursor [Ho... 35 0.023 gi|9558729 golgi associated, gamma adaptin ear containing, ARF b... 33 0.067 gi|48527952 golgi associated, gamma adaptin ear containing, ARF ... 33 0.067 gi|130502140 NEZHA isoform 2 [Homo sapiens] 33 0.11 gi|122937255 NEZHA isoform 1 [Homo sapiens] 33 0.11 gi|221139761 zinc finger protein 853 [Homo sapiens] 32 0.25 gi|239582767 slingshot homolog 3 [Homo sapiens] 32 0.25 gi|24308394 hypothetical protein LOC140893 [Homo sapiens] 32 0.25 gi|19924099 synapsin I isoform Ia [Homo sapiens] 31 0.43 gi|71725360 zinc finger protein 609 [Homo sapiens] 30 0.57 gi|7656879 ALL1 fused gene from 5q31 [Homo sapiens] 30 0.57 gi|18375609 dachshund homolog 1 isoform c [Homo sapiens] 30 0.96 gi|169171269 PREDICTED: similar to forkhead box L2 [Homo sapiens] 30 0.96 gi|222352183 neural precursor cell expressed, developmentally do... 29 1.3 gi|21361472 neural precursor cell expressed, developmentally dow... 29 1.3 gi|222352094 neural precursor cell expressed, developmentally do... 29 1.3 gi|222352092 neural precursor cell expressed, developmentally do... 29 1.3 gi|222352090 neural precursor cell expressed, developmentally do... 29 1.3 gi|222352088 neural precursor cell expressed, developmentally do... 29 1.3 gi|222352086 neural precursor cell expressed, developmentally do... 29 1.3 gi|222352084 neural precursor cell expressed, developmentally do... 29 1.3 gi|222352082 neural precursor cell expressed, developmentally do... 29 1.3 gi|18375613 dachshund homolog 1 isoform b [Homo sapiens] 29 1.3 gi|18375611 dachshund homolog 1 isoform a [Homo sapiens] 29 1.3 gi|19923343 Cbp/p300-interacting transactivator, with Glu/Asp-ri... 29 1.3 gi|17511435 roundabout homolog 4, magic roundabout [Homo sapiens] 29 1.3 gi|122937267 lemur tyrosine kinase 3 [Homo sapiens] 29 1.3 gi|226246533 TOX high mobility group box family member 3 isoform... 29 1.6 gi|226054295 TOX high mobility group box family member 3 isoform... 29 1.6 >gi|239755869 PREDICTED: hypothetical protein [Homo sapiens] Length = 148 Score = 303 bits (777), Expect = 3e-83 Identities = 148/148 (100%), Positives = 148/148 (100%) Query: 1 MSRVFCQELLLSEDTNSLVIGWWIEEYFPDFAYFQLPSAIHKHSLMLCIGRPGIEGNTQL 60 MSRVFCQELLLSEDTNSLVIGWWIEEYFPDFAYFQLPSAIHKHSLMLCIGRPGIEGNTQL Sbjct: 1 MSRVFCQELLLSEDTNSLVIGWWIEEYFPDFAYFQLPSAIHKHSLMLCIGRPGIEGNTQL 60 Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQVYKL 120 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQVYKL Sbjct: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQVYKL 120 Query: 121 FNEIRAPQPALAQRESKRMFLQQLSFLL 148 FNEIRAPQPALAQRESKRMFLQQLSFLL Sbjct: 121 FNEIRAPQPALAQRESKRMFLQQLSFLL 148 >gi|32261332 seizure related 6 homolog (mouse)-like precursor [Homo sapiens] Length = 1024 Score = 35.0 bits (79), Expect = 0.023 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Query: 59 QLPQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQV 117 +LP ++ RP+A S T+Q S PAS+ L+LL S+S+ +P PP P P V Sbjct: 118 KLPSLKQVNSARKQLRPKATSAATVQRAGSQPASQG-LDLL-SSSTEKPGPPGDPDPIV 174 >gi|9558729 golgi associated, gamma adaptin ear containing, ARF binding protein 1 isoform 1 [Homo sapiens] Length = 639 Score = 33.5 bits (75), Expect = 0.067 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 61 PQSREARERESWPRPRAG-SPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAP 115 P+S++ R + P PR L + S S LL++ S PRPPQ P P Sbjct: 437 PESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQPVP 492 >gi|48527952 golgi associated, gamma adaptin ear containing, ARF binding protein 1 isoform 2 [Homo sapiens] Length = 552 Score = 33.5 bits (75), Expect = 0.067 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 61 PQSREARERESWPRPRAG-SPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAP 115 P+S++ R + P PR L + S S LL++ S PRPPQ P P Sbjct: 350 PESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQPVP 405 >gi|130502140 NEZHA isoform 2 [Homo sapiens] Length = 1249 Score = 32.7 bits (73), Expect = 0.11 Identities = 19/47 (40%), Positives = 24/47 (51%) Query: 73 PRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQVYK 119 P RA SP L S LP SRE S +SS P++ P++YK Sbjct: 1068 PTSRAPSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYK 1114 >gi|122937255 NEZHA isoform 1 [Homo sapiens] Length = 1276 Score = 32.7 bits (73), Expect = 0.11 Identities = 19/47 (40%), Positives = 24/47 (51%) Query: 73 PRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQVYK 119 P RA SP L S LP SRE S +SS P++ P++YK Sbjct: 1095 PTSRAPSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYK 1141 >gi|221139761 zinc finger protein 853 [Homo sapiens] Length = 659 Score = 31.6 bits (70), Expect = 0.25 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 15/100 (15%) Query: 53 GIEGNTQLPQSREARERESWP-RPRAGSPLTLQ--GHSSLPASREL-LELLNSTSSSQPR 108 G G ++ + E +ER S P RP +P+ + P REL L+ L QP Sbjct: 44 GGSGGSESQEEEEPQERNSSPQRPAVSAPVGASEIAEETRPGQRELQLQQLEQ----QPE 99 Query: 109 PPQHPAPQVYKLFNEIRAPQPAL-AQRESKRMFLQQLSFL 147 P Q P + +++ PQP L Q++ ++ QQLS L Sbjct: 100 PQQQPQHE------QLQQPQPHLELQQQPQQDGQQQLSQL 133 >gi|239582767 slingshot homolog 3 [Homo sapiens] Length = 659 Score = 31.6 bits (70), Expect = 0.25 Identities = 31/96 (32%), Positives = 42/96 (43%), Gaps = 13/96 (13%) Query: 53 GIEGNTQLPQSREARERESWPRPRAGSPLTLQGHSSLPASRELL---------ELLNSTS 103 G E + +S+ A + E PRPR ++ S L S EL E+ +S Sbjct: 508 GEEKVVGMEESQAAPKEEPGPRPRINLRGVMRSISLLEPSLELESTSETSDMPEVFSSHE 567 Query: 104 SSQPRPPQHPAPQVYKLFNEI---RAPQPALAQRES 136 SS P Q P PQ+ + R PQPAL R+S Sbjct: 568 SSHEEPLQ-PFPQLARTKGGQQVDRGPQPALKSRQS 602 >gi|24308394 hypothetical protein LOC140893 [Homo sapiens] Length = 664 Score = 31.6 bits (70), Expect = 0.25 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Query: 58 TQLPQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAP 115 T++P+ EA RP GS L+L S P S E + P+PP HP P Sbjct: 498 TRVPEQEEASTPMDPSRPLPGSQLSL----SSPGSTEDEDTGRPLPPPHPQPPPHPQP 551 >gi|19924099 synapsin I isoform Ia [Homo sapiens] Length = 705 Score = 30.8 bits (68), Expect = 0.43 Identities = 29/99 (29%), Positives = 40/99 (40%), Gaps = 15/99 (15%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSS--LPASRELLELLNSTSSSQPRP-------PQ 111 P + ++ P PR G P T Q S PA R +L S P P P Sbjct: 597 PAGPTRQASQAGPVPRTGPPTTQQPRPSGPGPAGRPKPQLAQKPSQDVPPPATAAAGGPP 656 Query: 112 HP----APQVYKLFN--EIRAPQPALAQRESKRMFLQQL 144 HP + + FN E P+P+L+Q E K ++ L Sbjct: 657 HPQLNKSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSL 695 >gi|71725360 zinc finger protein 609 [Homo sapiens] Length = 1411 Score = 30.4 bits (67), Expect = 0.57 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Query: 50 GRPGIEGNTQLPQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRP 109 G+ + +LP S E+R PRP P++ S L + + ++ S SQ Sbjct: 1183 GKESTSSDCKLPTSEESRLGSKEPRPSVHVPVS----SPLTQHQSYIPYMHGYSYSQSYD 1238 Query: 110 PQHPA 114 P HP+ Sbjct: 1239 PNHPS 1243 >gi|7656879 ALL1 fused gene from 5q31 [Homo sapiens] Length = 1163 Score = 30.4 bits (67), Expect = 0.57 Identities = 22/78 (28%), Positives = 31/78 (39%) Query: 67 RERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQVYKLFNEIRA 126 +E +S PRP A S SRE++E S+S S P+ Q K R Sbjct: 615 KESKSSPRPTAEKKKYKSTSKSSQKSREIIETDTSSSDSDESESLPPSSQTPKYPESNRT 674 Query: 127 PQPALAQRESKRMFLQQL 144 P + E F Q++ Sbjct: 675 PVKPSSVEEEDSFFRQRM 692 >gi|18375609 dachshund homolog 1 isoform c [Homo sapiens] Length = 504 Score = 29.6 bits (65), Expect = 0.96 Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 80 PLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQVY 118 P T + S P +R+ L+ L+ T QP PP P+P ++ Sbjct: 319 PPTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLF 357 >gi|169171269 PREDICTED: similar to forkhead box L2 [Homo sapiens] Length = 632 Score = 29.6 bits (65), Expect = 0.96 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 56 GNTQLPQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPR-PPQHPA 114 GN + + R +RE PRAG G S LPA++ L ++ + R PP PA Sbjct: 123 GNYRRRRRRRGPKREGPRGPRAGGAQGPSGPSELPAAQGRLAPDSAGEGAPGREPPASPA 182 Query: 115 P 115 P Sbjct: 183 P 183 >gi|222352183 neural precursor cell expressed, developmentally down-regulated 4-like isoform 2 [Homo sapiens] Length = 854 Score = 29.3 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQ 116 PQ R R S P L+G P R + + L++ S QP P P PQ Sbjct: 318 PQIRRPRSLSS---PTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQ 370 >gi|21361472 neural precursor cell expressed, developmentally down-regulated 4-like isoform 3 [Homo sapiens] Length = 955 Score = 29.3 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQ 116 PQ R R S P L+G P R + + L++ S QP P P PQ Sbjct: 419 PQIRRPRSLSS---PTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQ 471 >gi|222352094 neural precursor cell expressed, developmentally down-regulated 4-like isoform 6 [Homo sapiens] Length = 834 Score = 29.3 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQ 116 PQ R R S P L+G P R + + L++ S QP P P PQ Sbjct: 298 PQIRRPRSLSS---PTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQ 350 >gi|222352092 neural precursor cell expressed, developmentally down-regulated 4-like isoform 6 [Homo sapiens] Length = 834 Score = 29.3 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQ 116 PQ R R S P L+G P R + + L++ S QP P P PQ Sbjct: 298 PQIRRPRSLSS---PTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQ 350 >gi|222352090 neural precursor cell expressed, developmentally down-regulated 4-like isoform 5 [Homo sapiens] Length = 947 Score = 29.3 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQ 116 PQ R R S P L+G P R + + L++ S QP P P PQ Sbjct: 411 PQIRRPRSLSS---PTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQ 463 >gi|222352088 neural precursor cell expressed, developmentally down-regulated 4-like isoform 4 [Homo sapiens] Length = 967 Score = 29.3 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQ 116 PQ R R S P L+G P R + + L++ S QP P P PQ Sbjct: 431 PQIRRPRSLSS---PTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQ 483 >gi|222352086 neural precursor cell expressed, developmentally down-regulated 4-like isoform 1 [Homo sapiens] Length = 975 Score = 29.3 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQ 116 PQ R R S P L+G P R + + L++ S QP P P PQ Sbjct: 439 PQIRRPRSLSS---PTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQ 491 >gi|222352084 neural precursor cell expressed, developmentally down-regulated 4-like isoform 2 [Homo sapiens] Length = 854 Score = 29.3 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQ 116 PQ R R S P L+G P R + + L++ S QP P P PQ Sbjct: 318 PQIRRPRSLSS---PTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQ 370 >gi|222352082 neural precursor cell expressed, developmentally down-regulated 4-like isoform 2 [Homo sapiens] Length = 854 Score = 29.3 bits (64), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 61 PQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQ 116 PQ R R S P L+G P R + + L++ S QP P P PQ Sbjct: 318 PQIRRPRSLSS---PTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQ 370 >gi|18375613 dachshund homolog 1 isoform b [Homo sapiens] Length = 558 Score = 29.3 bits (64), Expect = 1.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 88 SLPASRELLELLNSTSSSQPRPPQHPAPQVY 118 S P +R+ L+ L+ T QP PP P+P ++ Sbjct: 381 STPTARDSLDKLSLTGHGQPLPPGFPSPFLF 411 >gi|18375611 dachshund homolog 1 isoform a [Homo sapiens] Length = 706 Score = 29.3 bits (64), Expect = 1.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 88 SLPASRELLELLNSTSSSQPRPPQHPAPQVY 118 S P +R+ L+ L+ T QP PP P+P ++ Sbjct: 529 STPTARDSLDKLSLTGHGQPLPPGFPSPFLF 559 >gi|19923343 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 [Homo sapiens] Length = 270 Score = 29.3 bits (64), Expect = 1.3 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 78 GSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQVY 118 G P+ QG SLPAS +L +L N + P P H P ++ Sbjct: 100 GPPVASQG-GSLPASMQLQKLNNQYFNHHPYPHNHYMPDLH 139 >gi|17511435 roundabout homolog 4, magic roundabout [Homo sapiens] Length = 1007 Score = 29.3 bits (64), Expect = 1.3 Identities = 20/73 (27%), Positives = 28/73 (38%), Gaps = 9/73 (12%) Query: 59 QLPQSREARERESWPRPRAGSPLTLQGHSSLPASRELLELLNSTSS---------SQPRP 109 +L + E P PRA SP T G+ S+P + E ++ + PRP Sbjct: 803 ELSEGEETPRNSVSPMPRAPSPPTTYGYISVPTASEFTDMGRTGGGVGPKGGVLLCPPRP 862 Query: 110 PQHPAPQVYKLFN 122 P P L N Sbjct: 863 CLTPTPSEGSLAN 875 >gi|122937267 lemur tyrosine kinase 3 [Homo sapiens] Length = 1489 Score = 29.3 bits (64), Expect = 1.3 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 5/90 (5%) Query: 60 LPQSREARERESWPRP-RAGSPLTLQGHSSLPASRELLELLNSTSSSQPRPPQHPAPQVY 118 LP EA+ R P P RA + +G P SR + S P+P + P++ Sbjct: 1179 LPPPPEAQPRRLEPAPPRARPEVAPEGEPGAPDSRAGGDTALSGDGDPPKP-ERKGPEMP 1237 Query: 119 KLFNEIRAPQPALAQRESKRMFLQQLSFLL 148 +LF ++ PQ E + L +LS L Sbjct: 1238 RLFLDLGPPQ---GNSEQIKARLSRLSLAL 1264 >gi|226246533 TOX high mobility group box family member 3 isoform 2 [Homo sapiens] Length = 571 Score = 28.9 bits (63), Expect = 1.6 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 94 ELLELLNSTSSSQPRPPQHP--APQVYKLFNEIRAPQPALAQRESK 137 +L +L + SQP P QH A Q+ I +PQPA Q +S+ Sbjct: 510 QLQQLQHMQHQSQPSPRQHSPVASQITSPIPAIGSPQPASQQHQSQ 555 >gi|226054295 TOX high mobility group box family member 3 isoform 1 [Homo sapiens] Length = 576 Score = 28.9 bits (63), Expect = 1.6 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 94 ELLELLNSTSSSQPRPPQHP--APQVYKLFNEIRAPQPALAQRESK 137 +L +L + SQP P QH A Q+ I +PQPA Q +S+ Sbjct: 515 QLQQLQHMQHQSQPSPRQHSPVASQITSPIPAIGSPQPASQQHQSQ 560 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.319 0.134 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,836,725 Number of Sequences: 37866 Number of extensions: 375605 Number of successful extensions: 1831 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 85 Number of HSP's that attempted gapping in prelim test: 1764 Number of HSP's gapped (non-prelim): 151 length of query: 148 length of database: 18,247,518 effective HSP length: 93 effective length of query: 55 effective length of database: 14,725,980 effective search space: 809928900 effective search space used: 809928900 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 57 (26.6 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.