BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18860888 WW domain-containing oxidoreductase isoform 3 [Homo sapiens] (36 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|18860888 WW domain-containing oxidoreductase isoform 3 [Homo ... 82 9e-17 gi|7706523 WW domain-containing oxidoreductase isoform 1 [Homo s... 80 3e-16 gi|18860884 WW domain-containing oxidoreductase isoform 2 [Homo ... 80 3e-16 gi|114520609 neural precursor cell expressed, developmentally do... 35 0.010 gi|114520607 neural precursor cell expressed, developmentally do... 35 0.010 gi|27477109 itchy homolog E3 ubiquitin protein ligase [Homo sapi... 31 0.24 gi|40806207 WW domain containing E3 ubiquitin protein ligase 2 i... 30 0.41 gi|5453898 protein (peptidyl-prolyl cis/trans isomerase) NIMA-in... 30 0.53 gi|222352183 neural precursor cell expressed, developmentally do... 29 0.69 gi|21361472 neural precursor cell expressed, developmentally dow... 29 0.69 gi|31317292 Smad ubiquitination regulatory factor 1 isoform 1 [H... 29 0.69 gi|31317290 Smad ubiquitination regulatory factor 1 isoform 2 [H... 29 0.69 gi|222352094 neural precursor cell expressed, developmentally do... 29 0.69 gi|222352092 neural precursor cell expressed, developmentally do... 29 0.69 gi|222352090 neural precursor cell expressed, developmentally do... 29 0.69 gi|222352088 neural precursor cell expressed, developmentally do... 29 0.69 gi|222352086 neural precursor cell expressed, developmentally do... 29 0.69 gi|222352084 neural precursor cell expressed, developmentally do... 29 0.69 gi|222352082 neural precursor cell expressed, developmentally do... 29 0.69 gi|194306653 Yes-associated protein 1, 65kDa isoform 1 [Homo sap... 29 0.69 gi|40806209 WW domain containing E3 ubiquitin protein ligase 2 i... 29 0.90 gi|12232397 SMAD specific E3 ubiquitin protein ligase 2 [Homo sa... 28 1.2 gi|13346498 WW domain containing transcription regulator 1 [Homo... 27 2.6 gi|40806211 WW domain containing E3 ubiquitin protein ligase 2 i... 27 3.4 gi|29789058 WW and C2 domain containing 1 isoform 3 [Homo sapiens] 27 3.4 gi|242247257 WW and C2 domain containing 1 isoform 2 [Homo sapiens] 27 3.4 gi|242247251 WW and C2 domain containing 1 isoform 1 [Homo sapiens] 27 3.4 gi|13654239 WW domain containing E3 ubiquitin protein ligase 1 [... 27 3.4 gi|27436957 membrane associated guanylate kinase, WW and PDZ dom... 27 4.5 gi|119220598 apolipoprotein B48 receptor [Homo sapiens] 26 5.9 >gi|18860888 WW domain-containing oxidoreductase isoform 3 [Homo sapiens] Length = 36 Score = 82.0 bits (201), Expect = 9e-17 Identities = 36/36 (100%), Positives = 36/36 (100%) Query: 1 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYAK 36 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYAK Sbjct: 1 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYAK 36 >gi|7706523 WW domain-containing oxidoreductase isoform 1 [Homo sapiens] Length = 414 Score = 80.1 bits (196), Expect = 3e-16 Identities = 35/35 (100%), Positives = 35/35 (100%) Query: 1 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYA 35 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYA Sbjct: 1 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYA 35 >gi|18860884 WW domain-containing oxidoreductase isoform 2 [Homo sapiens] Length = 189 Score = 80.1 bits (196), Expect = 3e-16 Identities = 35/35 (100%), Positives = 35/35 (100%) Query: 1 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYA 35 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYA Sbjct: 1 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYA 35 >gi|114520609 neural precursor cell expressed, developmentally down-regulated 4 isoform 1 [Homo sapiens] Length = 900 Score = 35.4 bits (80), Expect = 0.010 Identities = 14/26 (53%), Positives = 18/26 (69%) Query: 9 LDDTDSEDELPPGWEERTTKDGWVYY 34 LD ++ LPPGWEERT DG ++Y Sbjct: 466 LDTSNDLGPLPPGWEERTHTDGRIFY 491 Score = 27.3 bits (59), Expect = 2.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Query: 9 LDDTDSEDELPPGWEERTTKDGWVYY 34 L LPPGWEER G YY Sbjct: 184 LQQQQEPSPLPPGWEERQDILGRTYY 209 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ + G YY Sbjct: 350 LPPGWEEKQDERGRSYY 366 >gi|114520607 neural precursor cell expressed, developmentally down-regulated 4 isoform 2 [Homo sapiens] Length = 1247 Score = 35.4 bits (80), Expect = 0.010 Identities = 14/26 (53%), Positives = 18/26 (69%) Query: 9 LDDTDSEDELPPGWEERTTKDGWVYY 34 LD ++ LPPGWEERT DG ++Y Sbjct: 813 LDTSNDLGPLPPGWEERTHTDGRIFY 838 Score = 27.3 bits (59), Expect = 2.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Query: 9 LDDTDSEDELPPGWEERTTKDGWVYY 34 L LPPGWEER G YY Sbjct: 531 LQQQQEPSPLPPGWEERQDILGRTYY 556 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ + G YY Sbjct: 697 LPPGWEEKQDERGRSYY 713 >gi|27477109 itchy homolog E3 ubiquitin protein ligase [Homo sapiens] Length = 862 Score = 30.8 bits (68), Expect = 0.24 Identities = 11/17 (64%), Positives = 14/17 (82%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWE+RT +G VY+ Sbjct: 399 LPPGWEKRTDSNGRVYF 415 Score = 30.4 bits (67), Expect = 0.31 Identities = 11/17 (64%), Positives = 13/17 (76%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWE+R + G VYY Sbjct: 287 LPPGWEQRVDQHGRVYY 303 Score = 30.0 bits (66), Expect = 0.41 Identities = 11/22 (50%), Positives = 13/22 (59%) Query: 13 DSEDELPPGWEERTTKDGWVYY 34 D + LPPGWE R G +YY Sbjct: 314 DRPEPLPPGWERRVDNMGRIYY 335 Score = 26.6 bits (57), Expect = 4.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 14 SEDELPPGWEERTTKDGWVYY 34 +E LP GWE R T DG Y+ Sbjct: 435 NEKPLPEGWEMRFTVDGIPYF 455 >gi|40806207 WW domain containing E3 ubiquitin protein ligase 2 isoform 1 [Homo sapiens] Length = 870 Score = 30.0 bits (66), Expect = 0.41 Identities = 13/23 (56%), Positives = 14/23 (60%) Query: 12 TDSEDELPPGWEERTTKDGWVYY 34 T E LPPGWE+RT G YY Sbjct: 326 TTWERPLPPGWEKRTDPRGRFYY 348 Score = 28.9 bits (63), Expect = 0.90 Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 16 DELPPGWEERTTKDGWVYY 34 D LP GWE+R +G VYY Sbjct: 300 DALPAGWEQRELPNGRVYY 318 Score = 26.9 bits (58), Expect = 3.4 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 11 DTDSEDELPPGWEERTTKDGWVYY 34 D D LPPGWE+R +G VYY Sbjct: 400 DHDPLGPLPPGWEKR-QDNGRVYY 422 Score = 26.9 bits (58), Expect = 3.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 15 EDELPPGWEERTTKDGWVYY 34 E LPPGWE + T +G Y+ Sbjct: 443 EPALPPGWEMKYTSEGVRYF 462 >gi|5453898 protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1 [Homo sapiens] Length = 163 Score = 29.6 bits (65), Expect = 0.53 Identities = 12/21 (57%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Query: 15 EDELPPGWEERTTK-DGWVYY 34 E++LPPGWE+R ++ G VYY Sbjct: 4 EEKLPPGWEKRMSRSSGRVYY 24 >gi|222352183 neural precursor cell expressed, developmentally down-regulated 4-like isoform 2 [Homo sapiens] Length = 854 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEER DG +Y Sbjct: 429 LPPGWEERIHLDGRTFY 445 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ G YY Sbjct: 74 LPPGWEEKVDNLGRTYY 90 Score = 25.8 bits (55), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEER G YY Sbjct: 266 LPSGWEERKDAKGRTYY 282 >gi|21361472 neural precursor cell expressed, developmentally down-regulated 4-like isoform 3 [Homo sapiens] Length = 955 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEER DG +Y Sbjct: 530 LPPGWEERIHLDGRTFY 546 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ G YY Sbjct: 195 LPPGWEEKVDNLGRTYY 211 Score = 25.8 bits (55), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEER G YY Sbjct: 367 LPSGWEERKDAKGRTYY 383 >gi|31317292 Smad ubiquitination regulatory factor 1 isoform 1 [Homo sapiens] Length = 757 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 13 DSEDELPPGWEERTTKDGWVYY 34 D LPPGWE R+T G +Y+ Sbjct: 303 DELGPLPPGWEVRSTVSGRIYF 324 Score = 28.1 bits (61), Expect = 1.5 Identities = 11/18 (61%), Positives = 14/18 (77%) Query: 17 ELPPGWEERTTKDGWVYY 34 ELP G+E+RTT G VY+ Sbjct: 235 ELPEGYEQRTTVQGQVYF 252 >gi|31317290 Smad ubiquitination regulatory factor 1 isoform 2 [Homo sapiens] Length = 731 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 13 DSEDELPPGWEERTTKDGWVYY 34 D LPPGWE R+T G +Y+ Sbjct: 277 DELGPLPPGWEVRSTVSGRIYF 298 Score = 28.1 bits (61), Expect = 1.5 Identities = 11/18 (61%), Positives = 14/18 (77%) Query: 17 ELPPGWEERTTKDGWVYY 34 ELP G+E+RTT G VY+ Sbjct: 235 ELPEGYEQRTTVQGQVYF 252 >gi|222352094 neural precursor cell expressed, developmentally down-regulated 4-like isoform 6 [Homo sapiens] Length = 834 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEER DG +Y Sbjct: 409 LPPGWEERIHLDGRTFY 425 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ G YY Sbjct: 74 LPPGWEEKVDNLGRTYY 90 Score = 25.8 bits (55), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEER G YY Sbjct: 246 LPSGWEERKDAKGRTYY 262 >gi|222352092 neural precursor cell expressed, developmentally down-regulated 4-like isoform 6 [Homo sapiens] Length = 834 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEER DG +Y Sbjct: 409 LPPGWEERIHLDGRTFY 425 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ G YY Sbjct: 74 LPPGWEEKVDNLGRTYY 90 Score = 25.8 bits (55), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEER G YY Sbjct: 246 LPSGWEERKDAKGRTYY 262 >gi|222352090 neural precursor cell expressed, developmentally down-regulated 4-like isoform 5 [Homo sapiens] Length = 947 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEER DG +Y Sbjct: 522 LPPGWEERIHLDGRTFY 538 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ G YY Sbjct: 187 LPPGWEEKVDNLGRTYY 203 Score = 25.8 bits (55), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEER G YY Sbjct: 359 LPSGWEERKDAKGRTYY 375 >gi|222352088 neural precursor cell expressed, developmentally down-regulated 4-like isoform 4 [Homo sapiens] Length = 967 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEER DG +Y Sbjct: 542 LPPGWEERIHLDGRTFY 558 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ G YY Sbjct: 187 LPPGWEEKVDNLGRTYY 203 Score = 25.8 bits (55), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEER G YY Sbjct: 379 LPSGWEERKDAKGRTYY 395 >gi|222352086 neural precursor cell expressed, developmentally down-regulated 4-like isoform 1 [Homo sapiens] Length = 975 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEER DG +Y Sbjct: 550 LPPGWEERIHLDGRTFY 566 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ G YY Sbjct: 195 LPPGWEEKVDNLGRTYY 211 Score = 25.8 bits (55), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEER G YY Sbjct: 387 LPSGWEERKDAKGRTYY 403 >gi|222352084 neural precursor cell expressed, developmentally down-regulated 4-like isoform 2 [Homo sapiens] Length = 854 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEER DG +Y Sbjct: 429 LPPGWEERIHLDGRTFY 445 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ G YY Sbjct: 74 LPPGWEEKVDNLGRTYY 90 Score = 25.8 bits (55), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEER G YY Sbjct: 266 LPSGWEERKDAKGRTYY 282 >gi|222352082 neural precursor cell expressed, developmentally down-regulated 4-like isoform 2 [Homo sapiens] Length = 854 Score = 29.3 bits (64), Expect = 0.69 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEER DG +Y Sbjct: 429 LPPGWEERIHLDGRTFY 445 Score = 27.3 bits (59), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWEE+ G YY Sbjct: 74 LPPGWEEKVDNLGRTYY 90 Score = 25.8 bits (55), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEER G YY Sbjct: 266 LPSGWEERKDAKGRTYY 282 >gi|194306653 Yes-associated protein 1, 65kDa isoform 1 [Homo sapiens] Length = 504 Score = 29.3 bits (64), Expect = 0.69 Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWE+ T+DG +YY Sbjct: 232 LPDGWEQAMTQDGEIYY 248 >gi|40806209 WW domain containing E3 ubiquitin protein ligase 2 isoform 3 [Homo sapiens] Length = 335 Score = 28.9 bits (63), Expect = 0.90 Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 16 DELPPGWEERTTKDGWVYY 34 D LP GWE+R +G VYY Sbjct: 300 DALPAGWEQRELPNGRVYY 318 >gi|12232397 SMAD specific E3 ubiquitin protein ligase 2 [Homo sapiens] Length = 748 Score = 28.5 bits (62), Expect = 1.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 15 EDELPPGWEERTTKDGWVYY 34 +++LP GWEER T G + Y Sbjct: 156 DNDLPDGWEERRTASGRIQY 175 Score = 28.5 bits (62), Expect = 1.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 18 LPPGWEERTTKDGWVYY 34 LPPGWE R T G VY+ Sbjct: 299 LPPGWEIRNTATGRVYF 315 Score = 28.1 bits (61), Expect = 1.5 Identities = 10/18 (55%), Positives = 15/18 (83%) Query: 17 ELPPGWEERTTKDGWVYY 34 +LP G+E+RTT+ G VY+ Sbjct: 252 DLPEGYEQRTTQQGQVYF 269 >gi|13346498 WW domain containing transcription regulator 1 [Homo sapiens] Length = 400 Score = 27.3 bits (59), Expect = 2.6 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AALRYAGLDDTDSEDELPPGWEERTTKDGWVYY 34 A LR D TD E LPPGWE T G Y+ Sbjct: 111 AHLRQQSYDVTD-ELPLPPGWEMTFTATGQRYF 142 >gi|40806211 WW domain containing E3 ubiquitin protein ligase 2 isoform 2 [Homo sapiens] Length = 431 Score = 26.9 bits (58), Expect = 3.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 15 EDELPPGWEERTTKDGWVYY 34 E LPPGWE + T +G Y+ Sbjct: 4 EPALPPGWEMKYTSEGVRYF 23 >gi|29789058 WW and C2 domain containing 1 isoform 3 [Homo sapiens] Length = 1113 Score = 26.9 bits (58), Expect = 3.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEE DG VYY Sbjct: 8 LPEGWEEARDFDGKVYY 24 >gi|242247257 WW and C2 domain containing 1 isoform 2 [Homo sapiens] Length = 1118 Score = 26.9 bits (58), Expect = 3.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEE DG VYY Sbjct: 8 LPEGWEEARDFDGKVYY 24 >gi|242247251 WW and C2 domain containing 1 isoform 1 [Homo sapiens] Length = 1119 Score = 26.9 bits (58), Expect = 3.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Query: 18 LPPGWEERTTKDGWVYY 34 LP GWEE DG VYY Sbjct: 8 LPEGWEEARDFDGKVYY 24 >gi|13654239 WW domain containing E3 ubiquitin protein ligase 1 [Homo sapiens] Length = 922 Score = 26.9 bits (58), Expect = 3.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 14 SEDELPPGWEERTTKDGWVYY 34 +E+ LP GWE R T++G Y+ Sbjct: 494 NEEPLPEGWEIRYTREGVRYF 514 Score = 26.6 bits (57), Expect = 4.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 11 DTDSEDELPPGWEERTTKDGWVYY 34 + D LPPGWE+R VY+ Sbjct: 451 ENDPYGPLPPGWEKRVDSTDRVYF 474 >gi|27436957 membrane associated guanylate kinase, WW and PDZ domain containing 2 [Homo sapiens] Length = 1455 Score = 26.6 bits (57), Expect = 4.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 10 DDTDSEDELPPGWEERTTKDGWVYY 34 +D + D LP WE T+ G VY+ Sbjct: 296 EDNEEPDPLPDNWEMAYTEKGEVYF 320 >gi|119220598 apolipoprotein B48 receptor [Homo sapiens] Length = 1088 Score = 26.2 bits (56), Expect = 5.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Query: 2 AALRYAGLDDTDSEDELPPGWEERTTKD 29 A R+AG ++ + P WE RT KD Sbjct: 595 AGPRHAGSVKPEASEAFPGAWENRTRKD 622 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.311 0.133 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,699,330 Number of Sequences: 37866 Number of extensions: 37170 Number of successful extensions: 204 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 114 Number of HSP's gapped (non-prelim): 93 length of query: 36 length of database: 18,247,518 effective HSP length: 11 effective length of query: 25 effective length of database: 17,830,992 effective search space: 445774800 effective search space used: 445774800 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.