BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|239749652 PREDICTED: hypothetical protein [Homo sapiens] (60 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|239749652 PREDICTED: hypothetical protein [Homo sapiens] 125 6e-30 gi|239749449 PREDICTED: hypothetical protein [Homo sapiens] 50 3e-07 gi|239757964 PREDICTED: hypothetical protein [Homo sapiens] 47 3e-06 gi|239750213 PREDICTED: hypothetical protein [Homo sapiens] 47 4e-06 gi|239754909 PREDICTED: hypothetical protein [Homo sapiens] 45 1e-05 gi|55769548 PHD finger protein 14 isoform 2 [Homo sapiens] 45 1e-05 gi|55769550 PHD finger protein 14 isoform 1 [Homo sapiens] 45 1e-05 gi|55741709 RNA binding motif protein 25 [Homo sapiens] 45 1e-05 gi|115298682 HBxAg transactivated protein 2 [Homo sapiens] 45 2e-05 gi|116008442 zinc finger CCCH-type containing 13 [Homo sapiens] 45 2e-05 gi|239508778 PREDICTED: hypothetical protein, partial [Homo sapi... 44 2e-05 gi|116089325 splicing factor, arginine/serine-rich 12 isoform a ... 44 2e-05 gi|21040255 splicing factor, arginine/serine-rich 12 isoform b [... 44 2e-05 gi|239747134 PREDICTED: hypothetical protein XP_002343921 [Homo ... 44 3e-05 gi|167614488 TBC1 domain family, member 10B [Homo sapiens] 44 4e-05 gi|197333879 genetic suppressor element 1 isoform 2 [Homo sapiens] 44 4e-05 gi|44955926 genetic suppressor element 1 isoform 1 [Homo sapiens] 44 4e-05 gi|68509926 DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Homo sapi... 44 4e-05 gi|239752449 PREDICTED: hypothetical protein [Homo sapiens] 43 5e-05 gi|239747891 PREDICTED: hypothetical protein [Homo sapiens] 43 6e-05 gi|31377595 zinc finger CCCH-type containing 18 [Homo sapiens] 43 6e-05 gi|207113164 Treacher Collins-Franceschetti syndrome 1 isoform f... 42 8e-05 gi|207113162 Treacher Collins-Franceschetti syndrome 1 isoform e... 42 8e-05 gi|207113160 Treacher Collins-Franceschetti syndrome 1 isoform d... 42 8e-05 gi|57164975 Treacher Collins-Franceschetti syndrome 1 isoform b ... 42 8e-05 gi|57164977 Treacher Collins-Franceschetti syndrome 1 isoform a ... 42 8e-05 gi|117553580 adaptor-related protein complex 3, delta 1 subunit ... 42 1e-04 gi|7662238 apoptotic chromatin condensation inducer 1 [Homo sapi... 41 2e-04 gi|151301171 RNA polymerase II transcription factor TAFII140 [Ho... 41 2e-04 gi|4757926 RNA binding motif protein 39 isoform b [Homo sapiens] 41 2e-04 >gi|239749652 PREDICTED: hypothetical protein [Homo sapiens] Length = 60 Score = 125 bits (315), Expect = 6e-30 Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRNGFQAIRTQR 60 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRNGFQAIRTQR Sbjct: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRNGFQAIRTQR 60 >gi|239749449 PREDICTED: hypothetical protein [Homo sapiens] Length = 275 Score = 50.4 bits (119), Expect = 3e-07 Identities = 19/37 (51%), Positives = 33/37 (89%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ERKR ++R++K+ KERK+E+E+G +E+KRKK K+++ Sbjct: 131 RERKRKKRRKKKRRKERKREKERGKRERKRKKRKKEE 167 Score = 47.0 bits (110), Expect = 3e-06 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 7/45 (15%) Query: 3 GGKERKRGRKRERKKEKERK-KEREKGNKE------KKRKKEKEK 40 G KE+K+ +KRER KE+ERK KEREK KE +KRKKEK+K Sbjct: 59 GKKEKKKRKKRERGKERERKRKEREKQRKERREKERRKRKKEKKK 103 Score = 46.2 bits (108), Expect = 6e-06 Identities = 20/41 (48%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Query: 5 KERKRGRKRER-KKEKERKKEREKGNKEKKRKKEKEKDHLE 44 +ER++ RKRER KKEK+++K+RE+G + ++++KE+EK E Sbjct: 48 REREKERKRERGKKEKKKRKKRERGKERERKRKEREKQRKE 88 Score = 45.8 bits (107), Expect = 7e-06 Identities = 20/40 (50%), Positives = 31/40 (77%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E KER+ KR+R++EKERK+ER K K+K++K+E+ K+ Sbjct: 35 ERKKERREREKRKREREKERKRERGKKEKKKRKKRERGKE 74 Score = 44.3 bits (103), Expect = 2e-05 Identities = 21/44 (47%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Query: 2 EGGKERKRGRK-RERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 E GKER+R RK RE+++++ R+KER K KEKK+++ K++ E Sbjct: 70 ERGKERERKRKEREKQRKERREKERRKRKKEKKKRERKQRGRRE 113 Score = 43.9 bits (102), Expect = 3e-05 Identities = 16/40 (40%), Positives = 32/40 (80%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 KER+ +R+RKKEK++++ +++G +E+K+KKE+++ E Sbjct: 87 KERREKERRKRKKEKKKRERKQRGRRERKKKKERKERERE 126 Score = 43.5 bits (101), Expect = 4e-05 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 4/59 (6%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK---GNKEKKRKKEKEKDHLEWVVTPRNGFQAIR 57 E K+R+R RK ERKKE+ERK+ RE+ KE+++KKE++KD T F+ +R Sbjct: 167 EREKKRERNRK-ERKKERERKERRERKKERKKERRKKKERKKDRKTDRQTDSQVFRPLR 224 Score = 43.1 bits (100), Expect = 5e-05 Identities = 18/37 (48%), Positives = 27/37 (72%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K RK+ R++ERK+EKER K K K KK ++EK+++ Sbjct: 137 KRRKKKRRKERKREKERGKRERKRKKRKKEEREKKRE 173 Score = 42.4 bits (98), Expect = 8e-05 Identities = 19/40 (47%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 K+R+RG++RERK+ KER+K+R++ ++++RK++KEK E Sbjct: 67 KKRERGKERERKR-KEREKQRKERREKERRKRKKEKKKRE 105 Score = 42.4 bits (98), Expect = 8e-05 Identities = 18/37 (48%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Query: 5 KER-KRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 KER KR RKR+++K++ER+K+RE+ KE+K+++E+++ Sbjct: 151 KERGKRERKRKKRKKEEREKKRERNRKERKKERERKE 187 Score = 42.0 bits (97), Expect = 1e-04 Identities = 19/36 (52%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +ERK+ +RERKK+KER KERE+ NK+++ +K K++ Sbjct: 104 RERKQRGRRERKKKKER-KERERENKQRRERKRKKR 138 Score = 41.6 bits (96), Expect = 1e-04 Identities = 19/43 (44%), Positives = 32/43 (74%), Gaps = 3/43 (6%) Query: 5 KERKRGR---KRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 KERKR + KRERK++K +K+EREK + +++++KE++ E Sbjct: 145 KERKREKERGKRERKRKKRKKEEREKKRERNRKERKKERERKE 187 Score = 40.8 bits (94), Expect = 2e-04 Identities = 17/35 (48%), Positives = 28/35 (80%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +R+ RK+ER++ ++RK+EREK K ++ KKEK+K Sbjct: 31 QRESERKKERREREKRKREREKERKRERGKKEKKK 65 Score = 39.7 bits (91), Expect = 5e-04 Identities = 14/38 (36%), Positives = 31/38 (81%) Query: 3 GGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 G +ERKR ++++ ++EK+R++ R++ KE++RK+ +E+ Sbjct: 154 GKRERKRKKRKKEEREKKRERNRKERKKERERKERRER 191 Score = 38.5 bits (88), Expect = 0.001 Identities = 13/37 (35%), Positives = 29/37 (78%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ++RK+ +K ER+K++ER ++ K +E+K ++E++K+ Sbjct: 158 RKRKKRKKEEREKKRERNRKERKKERERKERRERKKE 194 Score = 37.4 bits (85), Expect = 0.003 Identities = 15/40 (37%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E GK R+R RK+ +K+E+E+K+ER + ++K+R++++ ++ Sbjct: 152 ERGK-RERKRKKRKKEEREKKRERNRKERKKERERKERRE 190 Score = 36.2 bits (82), Expect = 0.006 Identities = 12/36 (33%), Positives = 30/36 (83%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +++KR RK+ ++E+++KKER++ +E K+++E+++ Sbjct: 100 EKKKRERKQRGRRERKKKKERKERERENKQRRERKR 135 Score = 35.8 bits (81), Expect = 0.008 Identities = 16/41 (39%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDH 42 E ++ +R RK+E+KK +ERK+ + K+KK +KE+E+++ Sbjct: 88 ERREKERRKRKKEKKK-RERKQRGRRERKKKKERKEREREN 127 Score = 35.8 bits (81), Expect = 0.008 Identities = 12/40 (30%), Positives = 32/40 (80%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 +++KR ++R+R+KE+ +++ + K K+++R+K++E++ E Sbjct: 139 RKKKRRKERKREKERGKRERKRKKRKKEEREKKRERNRKE 178 Score = 35.4 bits (80), Expect = 0.010 Identities = 14/40 (35%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Query: 5 KERKRGRKRERKKEKERKKE----REKGNKEKKRKKEKEK 40 +E +R ++R +++++R++E RE+G KEKK++K++E+ Sbjct: 32 RESERKKERREREKRKREREKERKRERGKKEKKKRKKRER 71 Score = 27.7 bits (60), Expect = 2.1 Identities = 12/27 (44%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Query: 16 KKEKERKKEREKGNKEKK-RKKEKEKD 41 ++E ERKKER + K K+ R+KE++++ Sbjct: 31 QRESERKKERREREKRKREREKERKRE 57 >gi|239757964 PREDICTED: hypothetical protein [Homo sapiens] Length = 290 Score = 47.0 bits (110), Expect = 3e-06 Identities = 20/38 (52%), Positives = 31/38 (81%) Query: 4 GKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 GKER R R R+ +++KERKKER+K KEKK+++++ +D Sbjct: 242 GKERDRERDRKEERKKERKKERKKERKEKKKEEKRRED 279 Score = 45.1 bits (105), Expect = 1e-05 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Query: 5 KERKRGRKRERKKE--KERKKEREKGNKEKKRKKEKEK 40 ++R+R RK ERKKE KERKKER++ KE+KR+++K++ Sbjct: 245 RDRERDRKEERKKERKKERKKERKEKKKEEKRREDKKR 282 Score = 42.4 bits (98), Expect = 8e-05 Identities = 18/31 (58%), Positives = 26/31 (83%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRK 35 +ERK+ RK+ERKKE++ KK+ EK ++KKRK Sbjct: 253 EERKKERKKERKKERKEKKKEEKRREDKKRK 283 Score = 40.8 bits (94), Expect = 2e-04 Identities = 16/36 (44%), Positives = 29/36 (80%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 ++R R R +ER +E++RK+ER+K K++++K+ KEK Sbjct: 235 RQRDRDRGKERDRERDRKEERKKERKKERKKERKEK 270 Score = 40.8 bits (94), Expect = 2e-04 Identities = 17/40 (42%), Positives = 31/40 (77%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 ++R + R RER +++ERKKER+K K+++++K+KE+ E Sbjct: 239 RDRGKERDRERDRKEERKKERKKERKKERKEKKKEEKRRE 278 Score = 39.7 bits (91), Expect = 5e-04 Identities = 19/56 (33%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRNGFQAIRTQR 60 K+ + R RER+K+K R++ER++G +E++R +++EK+ R+G + T+R Sbjct: 117 KQTEIERDREREKQKGRERERDRG-RERERDRDREKERERQTEKDRDGQRETETER 171 Score = 39.7 bits (91), Expect = 5e-04 Identities = 18/46 (39%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKE---KKRKKEKEKDHLE 44 EG +E R R+R+R +++ ++++RE+ KE K+RKKE++K+ E Sbjct: 224 EGERETDRRRERQRDRDRGKERDRERDRKEERKKERKKERKKERKE 269 Score = 38.5 bits (88), Expect = 0.001 Identities = 16/45 (35%), Positives = 33/45 (73%), Gaps = 7/45 (15%) Query: 4 GKERKRGRKRERKKEKERKKEREK-------GNKEKKRKKEKEKD 41 G+ER+R R RER+++++R+KERE+ G +E + ++E++++ Sbjct: 132 GRERERDRGRERERDRDREKERERQTEKDRDGQRETETERERDRE 176 Score = 37.0 bits (84), Expect = 0.003 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 5/50 (10%) Query: 6 ERKRGRKRERKKEKERKKEREKG-----NKEKKRKKEKEKDHLEWVVTPR 50 E +R R RER+K+KER+ ER++ KE++R+ ++E+D T R Sbjct: 168 ETERERDREREKQKERETERDRDRQRDTEKERERQTDRERDRQRKTQTER 217 Score = 36.6 bits (83), Expect = 0.004 Identities = 17/40 (42%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E K++ R R+R+R +E+ER ++RE KE++R+ EK++D Sbjct: 126 EREKQKGRERERDRGRERERDRDRE---KERERQTEKDRD 162 Score = 35.4 bits (80), Expect = 0.010 Identities = 19/41 (46%), Positives = 29/41 (70%), Gaps = 2/41 (4%) Query: 2 EGGKERKRGRKRERK-KEKERKKEREKGNK-EKKRKKEKEK 40 E ++RKR R+R RK KE R ++REK + E+ R++EK+K Sbjct: 91 ERDRDRKRDRERRRKEKETNRNRDREKQTEIERDREREKQK 131 Score = 34.7 bits (78), Expect = 0.017 Identities = 16/41 (39%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKERE-KGNKEKKRKKEKEKD 41 E ++R R ++RER+ EK+R +RE + +E+ R++EK+K+ Sbjct: 142 ERERDRDREKERERQTEKDRDGQRETETERERDREREKQKE 182 Score = 34.3 bits (77), Expect = 0.022 Identities = 13/40 (32%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +G +E + R+R+R++EK++++E E+ +++++R EKE++ Sbjct: 162 DGQRETETERERDREREKQKERETER-DRDRQRDTEKERE 200 Score = 33.5 bits (75), Expect = 0.038 Identities = 13/38 (34%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Query: 5 KERKRGR-KRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER R R K E++++++RK++RE+ KEK+ + ++++ Sbjct: 79 RERDRVREKTEKERDRDRKRDRERRRKEKETNRNRDRE 116 Score = 33.1 bits (74), Expect = 0.049 Identities = 12/36 (33%), Positives = 26/36 (72%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E++R R R+R +E+ RK++ N++++++ E E+D Sbjct: 89 EKERDRDRKRDRERRRKEKETNRNRDREKQTEIERD 124 Score = 33.1 bits (74), Expect = 0.049 Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 15/52 (28%) Query: 4 GKERKRGRKRERKKEK--------------ERKKEREKGNKEKKRKKEKEKD 41 G+ER+R R RE+++E+ ER+++RE+ K+K+R+ E+++D Sbjct: 140 GRERERDRDREKERERQTEKDRDGQRETETERERDRER-EKQKERETERDRD 190 Score = 33.1 bits (74), Expect = 0.049 Identities = 13/36 (36%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ER R R+R+ +KE+ER+ +RE+ ++++K + E++++ Sbjct: 186 ERDRDRQRDTEKERERQTDRER-DRQRKTQTERQRE 220 Score = 32.0 bits (71), Expect = 0.11 Identities = 14/43 (32%), Positives = 30/43 (69%), Gaps = 3/43 (6%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKG---NKEKKRKKEKEKD 41 E +E R +RE + +ER+++R++G ++E+ RK+E++K+ Sbjct: 216 ERQRETDREGERETDRRRERQRDRDRGKERDRERDRKEERKKE 258 Score = 31.6 bits (70), Expect = 0.14 Identities = 10/35 (28%), Positives = 27/35 (77%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKE 39 ++ ++ R R+RK+++ER+++ ++ N+ + R+K+ E Sbjct: 86 EKTEKERDRDRKRDRERRRKEKETNRNRDREKQTE 120 Score = 30.0 bits (66), Expect = 0.42 Identities = 14/60 (23%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKDHLEWVVTPRNGFQAIRTQR 60 E ++ +R + ER++++ER+K++E+ +++ R+++ EK+ R+ + +T+R Sbjct: 158 EKDRDGQRETETERERDREREKQKERETERDRDRQRDTEKERERQTDRERDRQRKTQTER 217 Score = 30.0 bits (66), Expect = 0.42 Identities = 12/53 (22%), Positives = 32/53 (60%), Gaps = 13/53 (24%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-------------GNKEKKRKKEKEKD 41 E ++R+R ++ER+++ +R+++R++ G +E R++E+++D Sbjct: 186 ERDRDRQRDTEKERERQTDRERDRQRKTQTERQRETDREGERETDRRRERQRD 238 Score = 27.3 bits (59), Expect = 2.7 Identities = 9/35 (25%), Positives = 24/35 (68%) Query: 10 GRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 G R+R++++ R+K ++ ++++KR +E+ + E Sbjct: 74 GDDRQRERDRVREKTEKERDRDRKRDRERRRKEKE 108 Score = 26.2 bits (56), Expect = 6.0 Identities = 8/34 (23%), Positives = 23/34 (67%) Query: 8 KRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K ++R+R ++++R++ R++ + R +EK+ + Sbjct: 87 KTEKERDRDRKRDRERRRKEKETNRNRDREKQTE 120 >gi|239750213 PREDICTED: hypothetical protein [Homo sapiens] Length = 248 Score = 46.6 bits (109), Expect = 4e-06 Identities = 18/36 (50%), Positives = 33/36 (91%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 KE+++ +++E++KEKE++KE+EK K+KK+KK+K+K Sbjct: 74 KEKEKEKEKEKEKEKEKEKEKEKEKKKKKKKKKKKK 109 Score = 46.6 bits (109), Expect = 4e-06 Identities = 18/36 (50%), Positives = 33/36 (91%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 KE+++ +++E++KEKE++KE+EK K+KK+KK+K+K Sbjct: 76 KEKEKEKEKEKEKEKEKEKEKEKKKKKKKKKKKKKK 111 Score = 43.5 bits (101), Expect = 4e-05 Identities = 17/38 (44%), Positives = 33/38 (86%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKE 39 E KE+++ +++E++KEKE++KE++K K+KK+KK+K+ Sbjct: 75 EKEKEKEKEKEKEKEKEKEKEKEKKKKKKKKKKKKKKK 112 Score = 37.4 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E KE+++ +++E++KEKE+KK+++K K+KK+KK K Sbjct: 79 EKEKEKEKEKEKEKEKEKEKKKKKKK-KKKKKKKKLNAK 116 Score = 35.0 bits (79), Expect = 0.013 Identities = 16/25 (64%), Positives = 23/25 (92%), Gaps = 1/25 (4%) Query: 17 KEKERKKEREKGNKEKKRKKEKEKD 41 KEKE++KE+EK KEK+++KEKEK+ Sbjct: 74 KEKEKEKEKEK-EKEKEKEKEKEKE 97 Score = 31.6 bits (70), Expect = 0.14 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Query: 11 RKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +K KE++KE+EK KEK+++KEKEK+ Sbjct: 66 KKTTTTTTKEKEKEKEK-EKEKEKEKEKEKE 95 Score = 29.6 bits (65), Expect = 0.55 Identities = 13/35 (37%), Positives = 23/35 (65%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E++ KR RKK+ +KK+++K +KK+K +K Sbjct: 18 EKESAWKRGRKKKTTKKKKKKKTTMKKKKKTTTKK 52 Score = 29.3 bits (64), Expect = 0.71 Identities = 13/30 (43%), Positives = 20/30 (66%) Query: 8 KRGRKRERKKEKERKKEREKGNKEKKRKKE 37 KRGRK++ K+K++KK K K+ KK+ Sbjct: 24 KRGRKKKTTKKKKKKKTTMKKKKKTTTKKK 53 Score = 28.1 bits (61), Expect = 1.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Query: 7 RKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +K+ + +K+ KK KEK+++KEKEK+ Sbjct: 51 KKKTTTKTKKRTTTTKKTTTTTTKEKEKEKEKEKE 85 Score = 26.9 bits (58), Expect = 3.5 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 8 KRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K+ +K KE+EK KEK+++KEKEK+ Sbjct: 59 KKRTTTTKKTTTTTTKEKEK-EKEKEKEKEKEKE 91 Score = 26.2 bits (56), Expect = 6.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K + +KR +K ++ KEK+++KEKEK+ Sbjct: 53 KTTTKTKKRTTTTKKTTTTTTKEKEKEKEKEKEKEKE 89 Score = 25.8 bits (55), Expect = 7.9 Identities = 10/34 (29%), Positives = 22/34 (64%) Query: 7 RKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +K+ K+++KK+ KK+++ K+K K K++ Sbjct: 28 KKKTTKKKKKKKTTMKKKKKTTTKKKTTTKTKKR 61 >gi|239754909 PREDICTED: hypothetical protein [Homo sapiens] Length = 245 Score = 45.4 bits (106), Expect = 1e-05 Identities = 20/38 (52%), Positives = 30/38 (78%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKE 39 EG KER+ RK+ER++ ++RK+EREK K ++ KKEK+ Sbjct: 50 EGKKERESERKKERREREKRKREREKERKRERGKKEKK 87 Score = 44.7 bits (104), Expect = 2e-05 Identities = 18/36 (50%), Positives = 28/36 (77%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +ERK RKRE +KE+ERKKE + +E+K +K++E+ Sbjct: 133 RERKEERKREERKERERKKEEREKERERKERKKRER 168 Score = 43.1 bits (100), Expect = 5e-05 Identities = 20/39 (51%), Positives = 29/39 (74%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E KER+ KR+R++EKERK+ER K K+ +RKKE+ + Sbjct: 58 ERKKERREREKRKREREKERKRERGKKEKKGERKKEERE 96 Score = 43.1 bits (100), Expect = 5e-05 Identities = 23/40 (57%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKK---RKKEKEKD 41 K+R+R RK ERKKE+ERK+ RE+ + KK RKKE++KD Sbjct: 187 KKRERNRK-ERKKERERKERRERKKERKKKEERKKERQKD 225 Score = 42.7 bits (99), Expect = 6e-05 Identities = 16/39 (41%), Positives = 32/39 (82%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E G+ K G++RERK+E++R++ +E+ K+++R+KE+E+ Sbjct: 122 ERGRTSKEGKERERKEERKREERKERERKKEEREKERER 160 Score = 42.0 bits (97), Expect = 1e-04 Identities = 19/39 (48%), Positives = 29/39 (74%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E ++ +R RK+ERKK++ERKKER+K + R+KE+ K Sbjct: 199 ERERKERRERKKERKKKEERKKERQKDRQTNWREKERGK 237 Score = 40.4 bits (93), Expect = 3e-04 Identities = 18/37 (48%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Query: 5 KERKR-GRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +ERK+ G K E +KEKERK+ +++ K+RKKE+E+ Sbjct: 166 RERKQVGEKEEERKEKERKERKKRERNRKERKKERER 202 Score = 40.0 bits (92), Expect = 4e-04 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 4/43 (9%) Query: 2 EGGKERKRGRK----RERKKEKERKKEREKGNKEKKRKKEKEK 40 E GK+ K+G + RERKK + K+ +E KEK++KKEK++ Sbjct: 80 ERGKKEKKGERKKEERERKKRRREKENKEGEEKEKRKKKEKKE 122 Score = 38.5 bits (88), Expect = 0.001 Identities = 15/37 (40%), Positives = 29/37 (78%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ERK+ RK++ +++KER+K+R+ +EK+R K + K+ Sbjct: 206 RERKKERKKKEERKKERQKDRQTNWREKERGKRERKE 242 Score = 38.1 bits (87), Expect = 0.002 Identities = 21/36 (58%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKE-KKRKKEKE 39 +ER++ RKRER K KE+K ER+K +E KKR++EKE Sbjct: 71 REREKERKRERGK-KEKKGERKKEERERKKRRREKE 105 Score = 38.1 bits (87), Expect = 0.002 Identities = 17/44 (38%), Positives = 32/44 (72%), Gaps = 4/44 (9%) Query: 5 KERKRGRKRERKKEKERK----KEREKGNKEKKRKKEKEKDHLE 44 +ER++ R+R+ +K++ERK KE E+ KE+K +K++E++ E Sbjct: 152 EEREKERERKERKKRERKQVGEKEEERKEKERKERKKRERNRKE 195 Score = 37.7 bits (86), Expect = 0.002 Identities = 20/47 (42%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Query: 2 EGGKERKRGRKRER-KKEKERKKEREKGNKEKKRKK---EKEKDHLE 44 E +ERKR ++ER +K++ER+KERE+ ++K+ +K EKE++ E Sbjct: 134 ERKEERKREERKERERKKEEREKERERKERKKRERKQVGEKEEERKE 180 Score = 37.7 bits (86), Expect = 0.002 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 4/44 (9%) Query: 2 EGGKERKRGRKRERKKEK----ERKKEREKGNKEKKRKKEKEKD 41 E +ERK ++ERKK + ERKKERE+ + +++K+ K+K+ Sbjct: 173 EKEEERKEKERKERKKRERNRKERKKERERKERRERKKERKKKE 216 Score = 36.6 bits (83), Expect = 0.004 Identities = 17/36 (47%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 KE K G ++E++K+KE KKER + +KE K ++ KE+ Sbjct: 104 KENKEGEEKEKRKKKE-KKERGRTSKEGKERERKEE 138 Score = 36.2 bits (82), Expect = 0.006 Identities = 18/42 (42%), Positives = 26/42 (61%) Query: 3 GGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 G + R R+RE + KE KKERE K+++R++EK K E Sbjct: 33 GWQSEIREREREIETRKEGKKERESERKKERREREKRKRERE 74 Score = 36.2 bits (82), Expect = 0.006 Identities = 16/47 (34%), Positives = 33/47 (70%), Gaps = 4/47 (8%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEK----KRKKEKEKDHLE 44 E + KR R+RE+++++ER K+ +KG ++K ++K+ +EK++ E Sbjct: 62 ERREREKRKREREKERKRERGKKEKKGERKKEERERKKRRREKENKE 108 Score = 36.2 bits (82), Expect = 0.006 Identities = 17/41 (41%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Query: 5 KERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKDHLE 44 ++++RGR + KE+ERK+ER++ KE++RKKE+ + E Sbjct: 119 EKKERGRTSKEGKERERKEERKREERKERERKKEEREKERE 159 Score = 35.0 bits (79), Expect = 0.013 Identities = 17/44 (38%), Positives = 31/44 (70%), Gaps = 3/44 (6%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 +E KE K+ R+ ERKKE+ +EREK +E+++++++E+ E Sbjct: 45 IETRKEGKKERESERKKER---REREKRKREREKERKRERGKKE 85 Score = 34.7 bits (78), Expect = 0.017 Identities = 17/44 (38%), Positives = 34/44 (77%), Gaps = 4/44 (9%) Query: 2 EGGKERKRGRK-RERKKEKERKKEREK---GNKEKKRKKEKEKD 41 E KER+R ++ RE+++E++ +K+RE+ G KE++RK+++ K+ Sbjct: 142 EERKERERKKEEREKERERKERKKRERKQVGEKEEERKEKERKE 185 Score = 34.7 bits (78), Expect = 0.017 Identities = 14/39 (35%), Positives = 30/39 (76%), Gaps = 3/39 (7%) Query: 2 EGGKERKRGRKRERKKEKERK---KEREKGNKEKKRKKE 37 E KERK+ +R+++++K+R+ +E+E+G +E+K +K+ Sbjct: 207 ERKKERKKKEERKKERQKDRQTNWREKERGKRERKERKK 245 Score = 34.3 bits (77), Expect = 0.022 Identities = 15/37 (40%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER+ ++E KKE+E ++++E+ +E KRK+E+EK+ Sbjct: 41 REREIETRKEGKKERESERKKERRERE-KRKREREKE 76 Score = 33.5 bits (75), Expect = 0.038 Identities = 13/40 (32%), Positives = 28/40 (70%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 K+R+R ++ + +EKE++K++EK + + K+ KE++ E Sbjct: 98 KKRRREKENKEGEEKEKRKKKEKKERGRTSKEGKERERKE 137 Score = 33.1 bits (74), Expect = 0.049 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 E KE + +KR R+KE + +E+EK ++KK KKE+ + E Sbjct: 89 ERKKEERERKKRRREKENKEGEEKEK--RKKKEKKERGRTSKE 129 Score = 32.3 bits (72), Expect = 0.084 Identities = 14/37 (37%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 KE + KR++K++KER + ++G KE++RK+E++++ Sbjct: 107 KEGEEKEKRKKKEKKERGRTSKEG-KERERKEERKRE 142 >gi|55769548 PHD finger protein 14 isoform 2 [Homo sapiens] Length = 888 Score = 45.4 bits (106), Expect = 1e-05 Identities = 22/40 (55%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 ME +E + G + +KKEKE++KE+EK KEK+R+KEKEK Sbjct: 99 MEKKEEEENGERPRKKKEKEKEKEKEK-EKEKEREKEKEK 137 Score = 33.1 bits (74), Expect = 0.049 Identities = 14/26 (53%), Positives = 20/26 (76%) Query: 16 KKEKERKKEREKGNKEKKRKKEKEKD 41 KKE+E ER + KEK+++KEKEK+ Sbjct: 101 KKEEEENGERPRKKKEKEKEKEKEKE 126 Score = 32.7 bits (73), Expect = 0.065 Identities = 13/37 (35%), Positives = 27/37 (72%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K+ + K+E ++ ER +++++ KEK+++KEKEK+ Sbjct: 94 KQLIKMEKKEEEENGERPRKKKEKEKEKEKEKEKEKE 130 Score = 28.9 bits (63), Expect = 0.93 Identities = 12/28 (42%), Positives = 19/28 (67%) Query: 14 ERKKEKERKKEREKGNKEKKRKKEKEKD 41 E++ K KKE E+ + ++KKEKEK+ Sbjct: 93 EKQLIKMEKKEEEENGERPRKKKEKEKE 120 >gi|55769550 PHD finger protein 14 isoform 1 [Homo sapiens] Length = 948 Score = 45.4 bits (106), Expect = 1e-05 Identities = 22/40 (55%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 ME +E + G + +KKEKE++KE+EK KEK+R+KEKEK Sbjct: 99 MEKKEEEENGERPRKKKEKEKEKEKEK-EKEKEREKEKEK 137 Score = 33.1 bits (74), Expect = 0.049 Identities = 14/26 (53%), Positives = 20/26 (76%) Query: 16 KKEKERKKEREKGNKEKKRKKEKEKD 41 KKE+E ER + KEK+++KEKEK+ Sbjct: 101 KKEEEENGERPRKKKEKEKEKEKEKE 126 Score = 32.7 bits (73), Expect = 0.065 Identities = 13/37 (35%), Positives = 27/37 (72%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K+ + K+E ++ ER +++++ KEK+++KEKEK+ Sbjct: 94 KQLIKMEKKEEEENGERPRKKKEKEKEKEKEKEKEKE 130 Score = 28.9 bits (63), Expect = 0.93 Identities = 12/28 (42%), Positives = 19/28 (67%) Query: 14 ERKKEKERKKEREKGNKEKKRKKEKEKD 41 E++ K KKE E+ + ++KKEKEK+ Sbjct: 93 EKQLIKMEKKEEEENGERPRKKKEKEKE 120 >gi|55741709 RNA binding motif protein 25 [Homo sapiens] Length = 843 Score = 45.1 bits (105), Expect = 1e-05 Identities = 20/43 (46%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 E +ER+R R+RER++E+ER++ERE+ +E++R+K+K++D E Sbjct: 394 ERERERERERERERERERERERERER-EREREREKDKKRDREE 435 Score = 44.3 bits (103), Expect = 2e-05 Identities = 19/37 (51%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER+R R+RER+KEKER++ERE+ ++++ R KE+++D Sbjct: 325 REREREREREREKEKERERERER-DRDRDRTKERDRD 360 Score = 44.3 bits (103), Expect = 2e-05 Identities = 20/40 (50%), Positives = 34/40 (85%), Gaps = 3/40 (7%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R R+RER++E+ER++ERE +E++R++E+EKD Sbjct: 392 ERERERERERERERERERERERERE---REREREREREKD 428 Score = 43.9 bits (102), Expect = 3e-05 Identities = 19/40 (47%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R R+RER++E+ER++ERE+ +EK +K+++E+D Sbjct: 398 ERERERERERERERERERERERERER-EREKDKKRDREED 436 Score = 43.9 bits (102), Expect = 3e-05 Identities = 19/43 (44%), Positives = 33/43 (76%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 E +ER+R R+RER++E+ER++ERE+ +K+ ++E E+D E Sbjct: 400 EREREREREREREREREREREREREREKDKKRDREEDEEDAYE 442 Score = 42.4 bits (98), Expect = 8e-05 Identities = 20/38 (52%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Query: 5 KERKRGRKRERK-KEKERKKEREKGNKEKKRKKEKEKD 41 +ER+R R+RER+ +E+ER++ERE+ KEK+R++E+E+D Sbjct: 312 RERERERERERRERERERERERER-EKEKERERERERD 348 Score = 41.6 bits (96), Expect = 1e-04 Identities = 20/41 (48%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Query: 2 EGGKERKRGR-KRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R R +RER++E+ER++EREK KE++R++E+++D Sbjct: 311 ERERERERERERREREREREREREREK-EKERERERERDRD 350 Score = 41.6 bits (96), Expect = 1e-04 Identities = 16/37 (43%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +E+ R R+RER++E+ER++ERE+ +E++R++E+E++ Sbjct: 385 REKSRDRERERERERERERERER-ERERERERERERE 420 Score = 40.8 bits (94), Expect = 2e-04 Identities = 15/37 (40%), Positives = 30/37 (81%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 KER+ K R++E+ER++ERE+ +E++R++E+E++ Sbjct: 300 KERQEIEKERRERERERERERERRERERERERERERE 336 Score = 40.8 bits (94), Expect = 2e-04 Identities = 18/43 (41%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKG---NKEKKRKKEKEKD 41 E +ER+R R+RE++KE+ER++ER++ KE+ R +++E+D Sbjct: 324 EREREREREREREKEKERERERERDRDRDRTKERDRDRDRERD 366 Score = 40.0 bits (92), Expect = 4e-04 Identities = 14/40 (35%), Positives = 32/40 (80%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +G KE++R + ++E+ER++ERE+ +E++R++E+E++ Sbjct: 295 KGKKEKERQEIEKERRERERERERERERRERERERERERE 334 Score = 39.7 bits (91), Expect = 5e-04 Identities = 15/37 (40%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 + R++ R RER++E+ER++ERE+ +E++R++E+E++ Sbjct: 383 RSREKSRDRERERERERERERER-ERERERERERERE 418 Score = 39.3 bits (90), Expect = 7e-04 Identities = 14/37 (37%), Positives = 30/37 (81%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ++ +R R+RER++E+ER++ + +E++R+KEKE++ Sbjct: 306 EKERRERERERERERERREREREREREREREKEKERE 342 Score = 39.3 bits (90), Expect = 7e-04 Identities = 15/37 (40%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K+R R R++ R +E+ER++ERE+ +E++R++E+E++ Sbjct: 379 KDRSRSREKSRDRERERERERER-ERERERERERERE 414 Score = 37.7 bits (86), Expect = 0.002 Identities = 14/37 (37%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 + R R + R+R++E+ER++ERE+ +E++R++E+E++ Sbjct: 381 RSRSREKSRDRERERERERERER-ERERERERERERE 416 Score = 37.0 bits (84), Expect = 0.003 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 11/51 (21%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKG-----------NKEKKRKKEKEKD 41 E +ER+R R R+R KE++R ++RE+ NK++ R +EK +D Sbjct: 340 ERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRD 390 Score = 37.0 bits (84), Expect = 0.003 Identities = 14/39 (35%), Positives = 30/39 (76%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +ER+R R+RER++EK++K++RE+ ++ +++ E+ Sbjct: 410 EREREREREREREREREKDKKRDREEDEEDAYERRKLER 448 Score = 36.6 bits (83), Expect = 0.004 Identities = 14/40 (35%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +R + R R R+K ++R++ERE+ +E++R++E+E++ Sbjct: 372 ERSSDRNKDRSRSREKSRDRERERER-ERERERERERERE 410 Score = 36.6 bits (83), Expect = 0.004 Identities = 13/37 (35%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 + + R R RE+ +++ER++ERE+ +E++R++E+E++ Sbjct: 377 RNKDRSRSREKSRDRERERERER-ERERERERERERE 412 Score = 35.8 bits (81), Expect = 0.008 Identities = 15/38 (39%), Positives = 29/38 (76%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKE 39 E +ER+R R+RER+K+K+R +E ++ + ++RK E++ Sbjct: 412 EREREREREREREREKDKKRDREEDEEDAYERRKLERK 449 Score = 34.3 bits (77), Expect = 0.022 Identities = 13/37 (35%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ++R+R R R+R++ +R K+R + ++EK R +E+E++ Sbjct: 361 RDRERDRDRDRERSSDRNKDRSR-SREKSRDRERERE 396 Score = 33.5 bits (75), Expect = 0.038 Identities = 13/38 (34%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 ++R R R+R + K+R + REK ++E++R++E+E++ Sbjct: 365 RDRDRDRERSSDRNKDRSRSREKSRDRERERERERERE 402 Score = 32.7 bits (73), Expect = 0.065 Identities = 11/37 (29%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER R ++R + +E+ ++RE+ +E++R++E+E++ Sbjct: 371 RERSSDRNKDRSRSREKSRDRER-ERERERERERERE 406 Score = 31.6 bits (70), Expect = 0.14 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDH 42 +ERK+ R+ E++ E+E ++ RE KE KR KE +D+ Sbjct: 467 RERKKTREYEKEAEREEERRREMA-KEAKRLKEFLEDY 503 Score = 30.8 bits (68), Expect = 0.25 Identities = 14/38 (36%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Query: 8 KRGRKRERKKEKERKK-EREKGNKEKKRKKEKEKDHLE 44 K+ + + KKEKER++ E+E+ +E++R++E+E+ E Sbjct: 289 KKLEEEKGKKEKERQEIEKERRERERERERERERRERE 326 Score = 30.0 bits (66), Expect = 0.42 Identities = 9/37 (24%), Positives = 28/37 (75%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +E K +++ER++ ++ ++ERE+ + ++ ++E+E++ Sbjct: 292 EEEKGKKEKERQEIEKERRERERERERERERRERERE 328 Score = 30.0 bits (66), Expect = 0.42 Identities = 14/50 (28%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE-WVVTPR 50 E +ER++ +KR+R++++E ER K ++ + K+ ++ L+ W + R Sbjct: 420 EREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRER 469 Score = 29.6 bits (65), Expect = 0.55 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKK-EKEKDHLE 44 ME K R+ + ++ +K E EKG KEK+R++ EKE+ E Sbjct: 269 MEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERE 313 Score = 29.6 bits (65), Expect = 0.55 Identities = 10/37 (27%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ++R+R R + + + R+K R++ +E++R++E+E++ Sbjct: 369 RDRERSSDRNKDRSRSREKSRDR-ERERERERERERE 404 Score = 28.5 bits (62), Expect = 1.2 Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 39/82 (47%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNK------------------------------- 30 E +ER+R R+RER++E+ER++EREK K Sbjct: 402 EREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERL 461 Query: 31 --------EKKRKKEKEKDHLE 44 +K R+ EKE + E Sbjct: 462 KNWEIRERKKTREYEKEAEREE 483 Score = 27.7 bits (60), Expect = 2.1 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ME ER+R + +++ E E ++E EK KE+KR++ E++ Sbjct: 565 MEQEAERRRQPQIKQEPESE-EEEEEKQEKEEKREEPMEEE 604 Score = 26.9 bits (58), Expect = 3.5 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 +E +R R+ + K+E E ++E E EK+ K+EK ++ +E Sbjct: 567 QEAERRRQPQIKQEPESEEEEE----EKQEKEEKREEPME 602 Score = 25.8 bits (55), Expect = 7.9 Identities = 9/24 (37%), Positives = 19/24 (79%) Query: 15 RKKEKERKKEREKGNKEKKRKKEK 38 +K+ ++R+KE E +++KR+KE+ Sbjct: 519 QKRLRDREKEMEADERDRKREKEE 542 >gi|115298682 HBxAg transactivated protein 2 [Homo sapiens] Length = 2817 Score = 44.7 bits (104), Expect = 2e-05 Identities = 22/41 (53%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNK-EKKRKKEKEKD 41 E KER++ R+R+++KEKE +KE+EK + EK+RK+EKEK+ Sbjct: 526 EREKEREKDRERQQEKEKELEKEQEKQREMEKERKQEKEKE 566 Score = 40.4 bits (93), Expect = 3e-04 Identities = 18/38 (47%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 +ER++ R+RE++ EKE+++EREK K+++R++EKEK+ Sbjct: 507 REREKEREREKELEKEQEQEREKEREKDRERQQEKEKE 544 Score = 40.4 bits (93), Expect = 3e-04 Identities = 19/38 (50%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKE 39 E KER+R ++ E+++E+ER+KEREK ++E++++KEKE Sbjct: 508 EREKEREREKELEKEQEQEREKEREK-DRERQQEKEKE 544 Score = 38.9 bits (89), Expect = 0.001 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 11/60 (18%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKK----------EKEKDHLEWVVTPR 50 +E +E++R ++ERK+EKE++ ER+K KEK+ +K EKE++ LE + PR Sbjct: 545 LEKEQEKQREMEKERKQEKEKELERQK-EKEKELQKMKEQEKECELEKEREKLEEKIEPR 603 Score = 37.7 bits (86), Expect = 0.002 Identities = 18/45 (40%), Positives = 33/45 (73%), Gaps = 5/45 (11%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKK-----RKKEKEKD 41 E +ER++ +++E +KE+E+++E EK K++K R+KEKEK+ Sbjct: 532 EKDRERQQEKEKELEKEQEKQREMEKERKQEKEKELERQKEKEKE 576 Score = 37.0 bits (84), Expect = 0.003 Identities = 16/34 (47%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Query: 7 RKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 R+R R++ER++EKE +KE+E+ +EK+R+K++E+ Sbjct: 505 REREREKEREREKELEKEQEQ-EREKEREKDRER 537 Score = 36.2 bits (82), Expect = 0.006 Identities = 16/30 (53%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Query: 13 RERKKEKERKKERE-KGNKEKKRKKEKEKD 41 RER++EKER++E+E + +E++R+KE+EKD Sbjct: 505 REREREKEREREKELEKEQEQEREKEREKD 534 Score = 36.2 bits (82), Expect = 0.006 Identities = 17/40 (42%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEK 40 E +E++ +++E+++EKER+K+RE+ KEK+ +KE+EK Sbjct: 512 EREREKELEKEQEQEREKEREKDRERQQEKEKELEKEQEK 551 >gi|116008442 zinc finger CCCH-type containing 13 [Homo sapiens] Length = 1564 Score = 44.7 bits (104), Expect = 2e-05 Identities = 17/36 (47%), Positives = 32/36 (88%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +R+R R+RER +EKER++ERE+ +E++R++E+E++ Sbjct: 734 DRERERERERDREKEREREREERERERERERERERE 769 Score = 43.9 bits (102), Expect = 3e-05 Identities = 21/47 (44%), Positives = 34/47 (72%), Gaps = 7/47 (14%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGN-------KEKKRKKEKEKD 41 E +ER+R R+RER++E+ER +EREK +E++R++EKE+D Sbjct: 678 ERDRERERDRERERERERERDREREKERELERERAREREREREKERD 724 Score = 43.5 bits (101), Expect = 4e-05 Identities = 16/40 (40%), Positives = 33/40 (82%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E ++R R+RER++E++R+KERE+ +E++R++E+E++ Sbjct: 726 ERDRDRDHDRERERERERDREKEREREREERERERERERE 765 Score = 42.4 bits (98), Expect = 8e-05 Identities = 15/37 (40%), Positives = 32/37 (86%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER+R R+R+R+KE+ER++E + +E++R++E+E++ Sbjct: 735 RERERERERDREKEREREREERERERERERERERERE 771 Score = 41.2 bits (95), Expect = 2e-04 Identities = 17/37 (45%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Query: 6 ERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 ER+R R+RER++EKER +ER++ + +++R++E+E+D Sbjct: 708 ERERAREREREREKERDRERDRDRDHDRERERERERD 744 Score = 40.8 bits (94), Expect = 2e-04 Identities = 18/42 (42%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKDH 42 E +ER R R++ER+ E+ER +ERE+ KE+ R++++++DH Sbjct: 692 ERERERDREREKERELERERAREREREREKERDRERDRDRDH 733 Score = 40.8 bits (94), Expect = 2e-04 Identities = 16/37 (43%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER+R R+RER++E+ER++ERE+ +E+ +++E+++D Sbjct: 754 EERERERERERERERERERERERA-RERDKERERQRD 789 Score = 40.4 bits (93), Expect = 3e-04 Identities = 13/37 (35%), Positives = 32/37 (86%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ++ R R+RER++++E+++ERE+ +E++R++E+E++ Sbjct: 731 RDHDRERERERERDREKEREREREERERERERERERE 767 Score = 39.7 bits (91), Expect = 5e-04 Identities = 17/39 (43%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +ER R R+R+R++E+ER++ER++ +EK+R+ E+E+ Sbjct: 674 ERARERDRERERDRERERERERERDR-EREKERELERER 711 Score = 38.9 bits (89), Expect = 0.001 Identities = 14/40 (35%), Positives = 30/40 (75%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER R R +R++E+ER+++REK + ++ ++E+E++ Sbjct: 722 ERDRERDRDRDHDRERERERERDREKEREREREERERERE 761 Score = 38.5 bits (88), Expect = 0.001 Identities = 15/40 (37%), Positives = 31/40 (77%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R R+RER++E+ER++ RE+ + ++++ ++KD Sbjct: 755 ERERERERERERERERERERERARERDKERERQRDWEDKD 794 Score = 38.5 bits (88), Expect = 0.001 Identities = 16/39 (41%), Positives = 30/39 (76%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +ER+R R+RER++E+ER +ER+K + ++ ++K+K Sbjct: 757 ERERERERERERERERERERARERDKERERQRDWEDKDK 795 Score = 38.5 bits (88), Expect = 0.001 Identities = 19/60 (31%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK-DHLEWVVTPRNGFQAIRTQR 60 E +ER+R R+R R+++KER+++R+ +K+K R +EK + + PR+G ++++ Sbjct: 765 ERERERERERERARERDKERERQRDWEDKDKGRDDRREKREEIREDRNPRDGHDERKSKK 824 Score = 38.1 bits (87), Expect = 0.002 Identities = 17/36 (47%), Positives = 29/36 (80%), Gaps = 3/36 (8%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ER R R RER++++ER++ERE +E+ R++EKE++ Sbjct: 674 ERARERDRERERDRERERERE---RERDREREKERE 706 Score = 38.1 bits (87), Expect = 0.002 Identities = 13/40 (32%), Positives = 31/40 (77%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R R++ER++E+E ++ + +E++R++E+E++ Sbjct: 736 ERERERERDREKEREREREERERERERERERERERERERE 775 Score = 37.7 bits (86), Expect = 0.002 Identities = 18/40 (45%), Positives = 33/40 (82%), Gaps = 4/40 (10%) Query: 5 KERKRGRK---RERKKEKERKKEREKGNKEKKRKKEKEKD 41 KER+R R+ RER++E+ER++ERE+ +E+ R+++KE++ Sbjct: 747 KEREREREERERERERERERERERER-ERERARERDKERE 785 Score = 37.0 bits (84), Expect = 0.003 Identities = 17/41 (41%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Query: 2 EGGKERKRGRKRE-RKKEKERKKEREKGNKEKKRKKEKEKD 41 E +E++R R+RE R++E+ER++ERE+ +E++R++ +E+D Sbjct: 742 ERDREKEREREREERERERERERERER-ERERERERARERD 781 Score = 37.0 bits (84), Expect = 0.003 Identities = 15/50 (30%), Positives = 34/50 (68%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRN 51 E +ER+R R+RER +E+++++ER++ ++K + ++ ++ E + RN Sbjct: 763 ERERERERERERERARERDKERERQRDWEDKDKGRDDRREKREEIREDRN 812 Score = 36.6 bits (83), Expect = 0.004 Identities = 16/36 (44%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +R+ R RER +E+ER +ERE+ +E++R +E+EK+ Sbjct: 670 DRRDERARERDRERERDRERER-ERERERDREREKE 704 Score = 35.8 bits (81), Expect = 0.008 Identities = 17/40 (42%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Query: 2 EGGKERKRGRKRER-KKEKERKKEREKGNKEKKRKKEKEK 40 E +ER R ++RER ++E+ER++ERE+ +E++R++E+E+ Sbjct: 738 ERERERDREKEREREREERERERERER-ERERERERERER 776 Score = 34.7 bits (78), Expect = 0.017 Identities = 13/42 (30%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 +E + R+R R+RE+++++ER ++R+ +E++R++++EK+ Sbjct: 707 LERERAREREREREKERDRERDRDRDHDRERERERERDREKE 748 Score = 32.3 bits (72), Expect = 0.084 Identities = 14/41 (34%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E +ER+ R +R+ E+ R+++RE+ ++E++R++E+E+D Sbjct: 658 ERREERRVDRVDDRRDERARERDRERERDRERERERERERD 698 Score = 30.4 bits (67), Expect = 0.32 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 5/42 (11%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHL 43 + K+ R R R+R +E+ER++ER +K+R ++E++ L Sbjct: 1326 DADKDWPRNRDRDRLRERERERER-----DKRRDLDRERERL 1362 Score = 27.7 bits (60), Expect = 2.1 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query: 4 GKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRNGFQAI 56 G+ ++ RK ERK+ R +E+E KEK +K+++ E + + R Q I Sbjct: 887 GRWKEEDRKPERKESSRRYEEQEL--KEKVSSVDKQREQTEILESSRMRAQDI 937 Score = 26.9 bits (58), Expect = 3.5 Identities = 12/41 (29%), Positives = 26/41 (63%), Gaps = 5/41 (12%) Query: 6 ERKRGRKRERKKEKERKKEREKG-----NKEKKRKKEKEKD 41 E R R+RER+ ++R+ +R+ N+++ R +E+E++ Sbjct: 1306 EHDRERERERRDTRQREWDRDADKDWPRNRDRDRLRERERE 1346 Score = 26.6 bits (57), Expect = 4.6 Identities = 10/35 (28%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Query: 11 RKRERKKEKERKKEREKGNKEKKRKKEKE---KDH 42 R+ ER+++ K++REK ++E++ ++ + +DH Sbjct: 412 RRHERREDTRGKRDREKDSREEREYEQDQSSSRDH 446 Score = 26.2 bits (56), Expect = 6.0 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Query: 16 KKEKERKKEREKGNKE--KKRKKEKEKDHLEW 45 +KE R + REK + + K+R E E++++EW Sbjct: 113 RKESSRGRHREKEDIKITKERTPESEEENVEW 144 >gi|239508778 PREDICTED: hypothetical protein, partial [Homo sapiens] Length = 123 Score = 44.3 bits (103), Expect = 2e-05 Identities = 16/37 (43%), Positives = 31/37 (83%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +E K G+++E++KEK ++KE++K KE +++KEKE++ Sbjct: 22 EEEKEGKRKEKRKEKRKEKEKKKKTKETEKRKEKEEE 58 Score = 42.0 bits (97), Expect = 1e-04 Identities = 17/36 (47%), Positives = 30/36 (83%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +E+KR RKR++KKE+E ++E E+ +E+K ++EKE+ Sbjct: 58 EEKKRKRKRKKKKEEEEREEEEEEEEEEKEEEEKEE 93 Score = 40.8 bits (94), Expect = 2e-04 Identities = 16/40 (40%), Positives = 31/40 (77%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 ++RK K+++ KE E++KE+E+ K++KRK++K+K+ E Sbjct: 35 EKRKEKEKKKKTKETEKRKEKEEEEKKRKRKRKKKKEEEE 74 Score = 39.3 bits (90), Expect = 7e-04 Identities = 16/36 (44%), Positives = 27/36 (75%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 ++ KR K ++KK KE +K +EK +EKKRK++++K Sbjct: 33 RKEKRKEKEKKKKTKETEKRKEKEEEEKKRKRKRKK 68 Score = 38.9 bits (89), Expect = 0.001 Identities = 17/36 (47%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +E++ GR+R++KK K R+KE E+ K+K+R+K K+K Sbjct: 89 EEKEEGRRRKKKK-KRRRKEEEEEKKKKRRRKTKKK 123 Score = 38.1 bits (87), Expect = 0.002 Identities = 15/37 (40%), Positives = 29/37 (78%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +E ++ RKR+RKK+KE ++ E+ +E++ K+E+EK+ Sbjct: 56 EEEEKKRKRKRKKKKEEEEREEEEEEEEEEKEEEEKE 92 Score = 36.6 bits (83), Expect = 0.004 Identities = 14/43 (32%), Positives = 30/43 (69%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 E KE++ K+ ++K K++K+E E+ +E++ ++EKE++ E Sbjct: 50 EKRKEKEEEEKKRKRKRKKKKEEEEREEEEEEEEEEKEEEEKE 92 Score = 36.2 bits (82), Expect = 0.006 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 13/56 (23%) Query: 2 EGGKERKRGRKR-ERKKEKERKK------------EREKGNKEKKRKKEKEKDHLE 44 E KE KR KR E++KEKE+KK E EK K K++KK++E++ E Sbjct: 22 EEEKEGKRKEKRKEKRKEKEKKKKTKETEKRKEKEEEEKKRKRKRKKKKEEEEREE 77 Score = 35.4 bits (80), Expect = 0.010 Identities = 14/43 (32%), Positives = 31/43 (72%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 E K+ K KR+ K+E+E+K++R++ K+++ ++E+E++ E Sbjct: 41 EKKKKTKETEKRKEKEEEEKKRKRKRKKKKEEEEREEEEEEEE 83 Score = 34.7 bits (78), Expect = 0.017 Identities = 14/39 (35%), Positives = 28/39 (71%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +E ++ R RKK+K+R+++ E+ K+KKR+++ +K Sbjct: 84 EEKEEEEKEEGRRRKKKKKRRRKEEEEEKKKKRRRKTKK 122 Score = 34.7 bits (78), Expect = 0.017 Identities = 14/32 (43%), Positives = 23/32 (71%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKK 33 E G+ RK+ +KR RK+E+E KK++ + +KK Sbjct: 92 EEGRRRKKKKKRRRKEEEEEKKKKRRRKTKKK 123 Score = 34.3 bits (77), Expect = 0.022 Identities = 14/37 (37%), Positives = 25/37 (67%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K++K + E +E E ++E+E KEK+++K KEK+ Sbjct: 5 KKKKETEETEETEETEEEEEKEGKRKEKRKEKRKEKE 41 Score = 34.3 bits (77), Expect = 0.022 Identities = 14/39 (35%), Positives = 25/39 (64%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +E++ K E ++ K++KK R K +E+K+KK + K Sbjct: 81 EEEEEKEEEEKEEGRRRKKKKKRRRKEEEEEKKKKRRRK 119 Score = 32.3 bits (72), Expect = 0.084 Identities = 12/43 (27%), Positives = 29/43 (67%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 E K +++ + +++K K +KK+ E+ +E++ ++E+EK+ E Sbjct: 48 ETEKRKEKEEEEKKRKRKRKKKKEEEEREEEEEEEEEEKEEEE 90 Score = 32.0 bits (71), Expect = 0.11 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Query: 2 EGGKERKRGRKRERKKEKERK---KEREKGNKEKKRKKEKEKDHLE 44 E +E + ++E K++++RK KE+EK K K+ +K KEK+ E Sbjct: 14 EETEETEEEEEKEGKRKEKRKEKRKEKEKKKKTKETEKRKEKEEEE 59 Score = 32.0 bits (71), Expect = 0.11 Identities = 10/40 (25%), Positives = 30/40 (75%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 K ++ +++E+++E++++K + K KE++ ++E+E++ E Sbjct: 45 KTKETEKRKEKEEEEKKRKRKRKKKKEEEEREEEEEEEEE 84 Score = 31.2 bits (69), Expect = 0.19 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Query: 2 EGGKERKRGRKRERK--KEKERKKEREKGNKEKKRKKEKEK 40 E +E + + E K K KE++KE+ K ++KK+ KE EK Sbjct: 11 EETEETEETEEEEEKEGKRKEKRKEKRKEKEKKKKTKETEK 51 Score = 30.8 bits (68), Expect = 0.25 Identities = 12/39 (30%), Positives = 26/39 (66%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +E + K E +KE+ R+++++K + K+ ++EK+K Sbjct: 76 EEEEEEEEEEKEEEEKEEGRRRKKKKKRRRKEEEEEKKK 114 Score = 29.3 bits (64), Expect = 0.71 Identities = 13/38 (34%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKE-RKKEREKGNKEKKRKKEKEKD 41 +E + + E ++EKE ++KE+ K +++K KK+K K+ Sbjct: 11 EETEETEETEEEEEKEGKRKEKRKEKRKEKEKKKKTKE 48 Score = 29.3 bits (64), Expect = 0.71 Identities = 10/39 (25%), Positives = 26/39 (66%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +E K ++E + +++KK+R + +E+++KK++ + Sbjct: 80 EEEEEEKEEEEKEEGRRRKKKKKRRRKEEEEEKKKKRRR 118 Score = 28.9 bits (63), Expect = 0.93 Identities = 14/36 (38%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRK-KEKEK 40 ++K+ +K+E ++ +E ++ E+ KE KRK K KEK Sbjct: 1 KKKKKKKKETEETEETEETEEEEEKEGKRKEKRKEK 36 Score = 28.1 bits (61), Expect = 1.6 Identities = 11/36 (30%), Positives = 24/36 (66%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 KE + + E +E+E K+ + K +++KRK++++K Sbjct: 8 KETEETEETEETEEEEEKEGKRKEKRKEKRKEKEKK 43 Score = 26.9 bits (58), Expect = 3.5 Identities = 10/26 (38%), Positives = 21/26 (80%) Query: 16 KKEKERKKEREKGNKEKKRKKEKEKD 41 KK+K++KKE E+ + ++ ++E+EK+ Sbjct: 1 KKKKKKKKETEETEETEETEEEEEKE 26 >gi|116089325 splicing factor, arginine/serine-rich 12 isoform a [Homo sapiens] Length = 624 Score = 44.3 bits (103), Expect = 2e-05 Identities = 21/44 (47%), Positives = 33/44 (75%), Gaps = 3/44 (6%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKG---NKEKKRKKEKEKDH 42 E +E++R +++ER K K+R KEREK +KEK R++E+EK+H Sbjct: 398 EREREKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEH 441 Score = 43.5 bits (101), Expect = 4e-05 Identities = 20/40 (50%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E + +++ R++ER++EKER+KE+E+G K K R KE+EKD Sbjct: 386 EKERVKEKDREKEREREKEREKEKERG-KNKDRDKEREKD 424 Score = 43.5 bits (101), Expect = 4e-05 Identities = 19/38 (50%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 KE+ R ++RER+KE+E++KER K +++K+R+K++EKD Sbjct: 391 KEKDREKEREREKEREKEKERGKNKDRDKEREKDREKD 428 Score = 42.0 bits (97), Expect = 1e-04 Identities = 20/41 (48%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E KE+ R R+RE++ EK+R KE+EK +KEK+R+K++ K+ Sbjct: 426 EKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKE 466 Score = 41.6 bits (96), Expect = 1e-04 Identities = 18/40 (45%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E KER + + R++++EK+R+K++EK ++E++R+KE EKD Sbjct: 406 EKEKERGKNKDRDKEREKDREKDKEK-DREREREKEHEKD 444 Score = 40.8 bits (94), Expect = 2e-04 Identities = 19/43 (44%), Positives = 31/43 (72%), Gaps = 3/43 (6%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNK---EKKRKKEKEKD 41 E GK + R ++RE+ +EK+++K+RE+ + EK R KEKEK+ Sbjct: 410 ERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKE 452 Score = 40.4 bits (93), Expect = 3e-04 Identities = 21/58 (36%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKDHLEWVVTPRNGFQAIRT 58 E +E+ + + RER++EKE +K+R+K KE+ ++KE+EKD + + R + RT Sbjct: 422 EKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSRT 479 Score = 39.7 bits (91), Expect = 5e-04 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 7/59 (11%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRNGFQAIRTQR 60 E K+R + +++E+ KEKER+K+R K EK++K +K + TP + A R R Sbjct: 440 EHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSR-------TPPRSYNASRRSR 491 Score = 38.1 bits (87), Expect = 0.002 Identities = 18/34 (52%), Positives = 29/34 (85%), Gaps = 3/34 (8%) Query: 7 RKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 R++ +++ER KEK+R+KERE +EK+R+KEKE+ Sbjct: 381 REKIKEKERVKEKDREKERE---REKEREKEKER 411 Score = 38.1 bits (87), Expect = 0.002 Identities = 16/38 (42%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 +E+ R + +E+ +E+ER+KE EK +KEK+++++KEK+ Sbjct: 421 REKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKE 458 Score = 37.0 bits (84), Expect = 0.003 Identities = 18/34 (52%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Query: 8 KRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 KR RE+ KEKER KE+++ KE++R+KE+EK+ Sbjct: 376 KRKDTREKIKEKERVKEKDR-EKEREREKEREKE 408 Score = 36.2 bits (82), Expect = 0.006 Identities = 16/37 (43%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K +++ R +E+ +EKER++E+E+ KEK+R K K++D Sbjct: 383 KIKEKERVKEKDREKEREREKER-EKEKERGKNKDRD 418 Score = 33.5 bits (75), Expect = 0.038 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Query: 7 RKRGRKRERKKEKERKKEREKGN------KEKKRKKEKEKD 41 +KR + RER+K + R R+K KEK+R KEK+++ Sbjct: 356 KKRSKSRERRKSRSRSHSRDKRKDTREKIKEKERVKEKDRE 396 Score = 33.1 bits (74), Expect = 0.049 Identities = 14/40 (35%), Positives = 25/40 (62%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E K R R R+++K+ K + ++ KEK R+KE+E++ Sbjct: 363 ERRKSRSRSHSRDKRKDTREKIKEKERVKEKDREKERERE 402 Score = 32.3 bits (72), Expect = 0.084 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Query: 5 KERKRGRK--RERKKEKERKKEREKGNKEKKRKKEKEK 40 K+R+R + ++R K +ER+K R + + KRK +EK Sbjct: 346 KDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTREK 383 Score = 30.4 bits (67), Expect = 0.32 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Query: 2 EGGK--ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDH 42 E GK ERK GR R + K R + +++ + K + + H Sbjct: 296 ESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSH 338 Score = 28.9 bits (63), Expect = 0.93 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 9/48 (18%) Query: 5 KERKRGRKRERK---------KEKERKKEREKGNKEKKRKKEKEKDHL 43 +ER+R R R K K + + +K +K+EKE+DH+ Sbjct: 495 RERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKREKERDHI 542 Score = 28.5 bits (62), Expect = 1.2 Identities = 12/41 (29%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Query: 5 KERKRGRKRERKKEKERKKERE-KGNKEKKRKKEKEKDHLE 44 + R++ R+R + K+R K RE + ++ + ++K KD E Sbjct: 342 RSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTRE 382 Score = 26.6 bits (57), Expect = 4.6 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Query: 7 RKRGRKRERKKEKERKKEREKGNK-----EKKRKKEKEK 40 RKR + + R + R + R+K + KKR K +E+ Sbjct: 326 RKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRER 364 Score = 26.2 bits (56), Expect = 6.0 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 6/39 (15%) Query: 12 KRERKKEKER-----KKEREKGNKEKKRKKEKE-KDHLE 44 K+++K+EKER ++ERE+ +K +++ K+ LE Sbjct: 530 KKDKKREKERDHISERRERERSTSMRKSSNDRDGKEKLE 568 Score = 25.8 bits (55), Expect = 7.9 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 11/49 (22%) Query: 5 KERKRGRKRER---KKEKER-----KKEREKGNKEKKRKKE---KEKDH 42 K++KR ++R+ ++E+ER K ++ KEK K KEK+H Sbjct: 531 KDKKREKERDHISERRERERSTSMRKSSNDRDGKEKLEKNSTSLKEKEH 579 >gi|21040255 splicing factor, arginine/serine-rich 12 isoform b [Homo sapiens] Length = 508 Score = 44.3 bits (103), Expect = 2e-05 Identities = 21/44 (47%), Positives = 33/44 (75%), Gaps = 3/44 (6%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKG---NKEKKRKKEKEKDH 42 E +E++R +++ER K K+R KEREK +KEK R++E+EK+H Sbjct: 282 EREREKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEH 325 Score = 43.5 bits (101), Expect = 4e-05 Identities = 20/40 (50%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E + +++ R++ER++EKER+KE+E+G K K R KE+EKD Sbjct: 270 EKERVKEKDREKEREREKEREKEKERG-KNKDRDKEREKD 308 Score = 43.5 bits (101), Expect = 4e-05 Identities = 19/38 (50%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 KE+ R ++RER+KE+E++KER K +++K+R+K++EKD Sbjct: 275 KEKDREKEREREKEREKEKERGKNKDRDKEREKDREKD 312 Score = 42.0 bits (97), Expect = 1e-04 Identities = 20/41 (48%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E KE+ R R+RE++ EK+R KE+EK +KEK+R+K++ K+ Sbjct: 310 EKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKE 350 Score = 41.6 bits (96), Expect = 1e-04 Identities = 18/40 (45%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E KER + + R++++EK+R+K++EK ++E++R+KE EKD Sbjct: 290 EKEKERGKNKDRDKEREKDREKDKEK-DREREREKEHEKD 328 Score = 40.8 bits (94), Expect = 2e-04 Identities = 19/43 (44%), Positives = 31/43 (72%), Gaps = 3/43 (6%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNK---EKKRKKEKEKD 41 E GK + R ++RE+ +EK+++K+RE+ + EK R KEKEK+ Sbjct: 294 ERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKE 336 Score = 40.4 bits (93), Expect = 3e-04 Identities = 21/58 (36%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKDHLEWVVTPRNGFQAIRT 58 E +E+ + + RER++EKE +K+R+K KE+ ++KE+EKD + + R + RT Sbjct: 306 EKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSRT 363 Score = 39.7 bits (91), Expect = 5e-04 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 7/59 (11%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRNGFQAIRTQR 60 E K+R + +++E+ KEKER+K+R K EK++K +K + TP + A R R Sbjct: 324 EHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKKDKKSR-------TPPRSYNASRRSR 375 Score = 38.1 bits (87), Expect = 0.002 Identities = 18/34 (52%), Positives = 29/34 (85%), Gaps = 3/34 (8%) Query: 7 RKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 R++ +++ER KEK+R+KERE +EK+R+KEKE+ Sbjct: 265 REKIKEKERVKEKDREKERE---REKEREKEKER 295 Score = 38.1 bits (87), Expect = 0.002 Identities = 16/38 (42%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 +E+ R + +E+ +E+ER+KE EK +KEK+++++KEK+ Sbjct: 305 REKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKE 342 Score = 37.0 bits (84), Expect = 0.003 Identities = 18/34 (52%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Query: 8 KRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 KR RE+ KEKER KE+++ KE++R+KE+EK+ Sbjct: 260 KRKDTREKIKEKERVKEKDR-EKEREREKEREKE 292 Score = 36.2 bits (82), Expect = 0.006 Identities = 16/37 (43%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K +++ R +E+ +EKER++E+E+ KEK+R K K++D Sbjct: 267 KIKEKERVKEKDREKEREREKER-EKEKERGKNKDRD 302 Score = 33.5 bits (75), Expect = 0.038 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Query: 7 RKRGRKRERKKEKERKKEREKGN------KEKKRKKEKEKD 41 +KR + RER+K + R R+K KEK+R KEK+++ Sbjct: 240 KKRSKSRERRKSRSRSHSRDKRKDTREKIKEKERVKEKDRE 280 Score = 33.1 bits (74), Expect = 0.049 Identities = 14/40 (35%), Positives = 25/40 (62%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E K R R R+++K+ K + ++ KEK R+KE+E++ Sbjct: 247 ERRKSRSRSHSRDKRKDTREKIKEKERVKEKDREKERERE 286 Score = 32.3 bits (72), Expect = 0.084 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Query: 5 KERKRGRK--RERKKEKERKKEREKGNKEKKRKKEKEK 40 K+R+R + ++R K +ER+K R + + KRK +EK Sbjct: 230 KDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTREK 267 Score = 30.4 bits (67), Expect = 0.32 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Query: 2 EGGK--ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDH 42 E GK ERK GR R + K R + +++ + K + + H Sbjct: 180 ESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSH 222 Score = 28.9 bits (63), Expect = 0.93 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 9/48 (18%) Query: 5 KERKRGRKRERK---------KEKERKKEREKGNKEKKRKKEKEKDHL 43 +ER+R R R K K + + +K +K+EKE+DH+ Sbjct: 379 RERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKREKERDHI 426 Score = 28.5 bits (62), Expect = 1.2 Identities = 12/41 (29%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Query: 5 KERKRGRKRERKKEKERKKERE-KGNKEKKRKKEKEKDHLE 44 + R++ R+R + K+R K RE + ++ + ++K KD E Sbjct: 226 RSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTRE 266 Score = 26.6 bits (57), Expect = 4.6 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Query: 7 RKRGRKRERKKEKERKKEREKGNK-----EKKRKKEKEK 40 RKR + + R + R + R+K + KKR K +E+ Sbjct: 210 RKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRER 248 Score = 26.2 bits (56), Expect = 6.0 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 6/39 (15%) Query: 12 KRERKKEKER-----KKEREKGNKEKKRKKEKE-KDHLE 44 K+++K+EKER ++ERE+ +K +++ K+ LE Sbjct: 414 KKDKKREKERDHISERRERERSTSMRKSSNDRDGKEKLE 452 Score = 25.8 bits (55), Expect = 7.9 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 11/49 (22%) Query: 5 KERKRGRKRER---KKEKER-----KKEREKGNKEKKRKKE---KEKDH 42 K++KR ++R+ ++E+ER K ++ KEK K KEK+H Sbjct: 415 KDKKREKERDHISERRERERSTSMRKSSNDRDGKEKLEKNSTSLKEKEH 463 >gi|239747134 PREDICTED: hypothetical protein XP_002343921 [Homo sapiens] Length = 600 Score = 43.9 bits (102), Expect = 3e-05 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 7/66 (10%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-------GNKEKKRKKEKEKDHLEWVVTPRNGFQ 54 E +ER+R RKRER++E+ER++ER++ +E+KRK++ E D T R G + Sbjct: 306 ERERERERNRKRERERERERERERQRETERDREKERERKRKRQTEMDRERNRQTGREGRR 365 Query: 55 AIRTQR 60 +R Sbjct: 366 QAERER 371 Score = 41.2 bits (95), Expect = 2e-04 Identities = 19/41 (46%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E +ER+R R+R RK+E+ER++ERE+ +E +R +EKE++ Sbjct: 302 ERQRERERERERNRKRERERERERERERQRETERDREKERE 342 Score = 41.2 bits (95), Expect = 2e-04 Identities = 17/38 (44%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 +ER+R R R+R+KE+ER+ E+++ G +E ++++E+EKD Sbjct: 386 EERERDRDRDRQKERERQTEKDRDGQRETEKQREREKD 423 Score = 40.8 bits (94), Expect = 2e-04 Identities = 18/41 (43%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E ++R+R R+RER++E+ RK+ERE+ +E++R++E E+D Sbjct: 296 ETERKRERQRERERERERNRKRERERERERERERQRETERD 336 Score = 39.3 bits (90), Expect = 7e-04 Identities = 16/36 (44%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ER+ RKRER++EK+R ++R++ ++E++R +EKE++ Sbjct: 72 ERETDRKRERRREKDRHRKRDR-HRERQRDREKERE 106 Score = 39.3 bits (90), Expect = 7e-04 Identities = 17/40 (42%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Query: 5 KERKRGRKRERKKEKERKKEREKG---NKEKKRKKEKEKD 41 ++R R R+R+R+KE+ER+ +RE+ KE+ R+KE+E++ Sbjct: 91 RDRHRERQRDREKERERQTDRERDRQREKERNRQKERERE 130 Score = 38.9 bits (89), Expect = 0.001 Identities = 15/37 (40%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ++R+ RKRER++E+ER++ER + +E++R++E+E++ Sbjct: 293 RDRETERKRERQRERERERERNR-KRERERERERERE 328 Score = 38.5 bits (88), Expect = 0.001 Identities = 16/40 (40%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E + RKR R RER++++E+++ER+ ++E+ R++EKE++ Sbjct: 84 EKDRHRKRDRHRERQRDREKERERQT-DRERDRQREKERN 122 Score = 38.5 bits (88), Expect = 0.001 Identities = 17/39 (43%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Query: 6 ERKRGRKRERKKEKERKKEREK---GNKEKKRKKEKEKD 41 +RKR R+ ER +E ERK+ER++ +E+ RK+E+E++ Sbjct: 284 DRKRQRRTERDRETERKRERQRERERERERNRKRERERE 322 Score = 38.1 bits (87), Expect = 0.002 Identities = 13/40 (32%), Positives = 31/40 (77%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 EG ++ +R R+RER+++++ +ERE+ +++ R ++KE++ Sbjct: 362 EGRRQAERERERERERDRQSAREREERERDRDRDRQKERE 401 Score = 37.7 bits (86), Expect = 0.002 Identities = 14/35 (40%), Positives = 27/35 (77%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 ER+R +RE +++KER++ER++ +R+KE+E+ Sbjct: 247 ERERASERETERDKERERERDRDRDRDRRQKERER 281 Score = 37.7 bits (86), Expect = 0.002 Identities = 14/41 (34%), Positives = 29/41 (70%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 M+ + R+ GR+ R+ E+ER++ERE+ + + ++E+E+D Sbjct: 351 MDRERNRQTGREGRRQAERERERERERDRQSAREREERERD 391 Score = 37.7 bits (86), Expect = 0.002 Identities = 16/54 (29%), Positives = 33/54 (61%) Query: 7 RKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRNGFQAIRTQR 60 R+ R+RER++E++R+ RE+ +E+ R ++++K+ R+G + QR Sbjct: 365 RQAERERERERERDRQSAREREERERDRDRDRQKERERQTEKDRDGQRETEKQR 418 Score = 37.4 bits (85), Expect = 0.003 Identities = 15/41 (36%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E +ER+ R+R+R+ E+ R+KERE+ N++++R++E++++ Sbjct: 156 EKERERQTDRERQRQTERNRQKEREREKNRQERRERERQRE 196 Score = 37.4 bits (85), Expect = 0.003 Identities = 16/41 (39%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKERE-KGNKEKKRKKEKEKD 41 E ++RK R+RE++ E+ER ERE + +KE++R++++++D Sbjct: 231 ERDRQRKTEREREKQAERERASERETERDKERERERDRDRD 271 Score = 37.0 bits (84), Expect = 0.003 Identities = 16/35 (45%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKE 39 +ER+R +R R+KE+ER+K R++ +E++R++EKE Sbjct: 165 RERQRQTERNRQKEREREKNRQE-RRERERQREKE 198 Score = 37.0 bits (84), Expect = 0.003 Identities = 14/38 (36%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 + +R R+ ERK+E++R++ERE+ N++++R++E+E++ Sbjct: 289 RRTERDRETERKRERQRERERERERNRKRERERERERE 326 Score = 35.8 bits (81), Expect = 0.008 Identities = 13/40 (32%), Positives = 29/40 (72%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E ++++R R++ R++ +ER+++REK NK + R E+ ++ Sbjct: 172 ERNRQKEREREKNRQERRERERQREKENKTEDRHSERGRE 211 Score = 35.8 bits (81), Expect = 0.008 Identities = 15/39 (38%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +E +R R+R+R++E+ER++ R K +E++R++E+E+ Sbjct: 292 ERDRETERKRERQRERERERERNR-KRERERERERERER 329 Score = 35.4 bits (80), Expect = 0.010 Identities = 13/40 (32%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E ++R++ R+R+ +E++R++E+E+ N++K+R++E E++ Sbjct: 96 ERQRDREKERERQTDRERDRQREKER-NRQKERERETERE 134 Score = 35.4 bits (80), Expect = 0.010 Identities = 15/42 (35%), Positives = 31/42 (73%), Gaps = 5/42 (11%) Query: 5 KERKRGRKRERKKEKERKKEREK-----GNKEKKRKKEKEKD 41 +E++R R++ER++E ER+ ER + G +E++R+++ EK+ Sbjct: 117 REKERNRQKERERETEREGERGRDRQTDGQRERERQRDAEKE 158 Score = 35.4 bits (80), Expect = 0.010 Identities = 15/39 (38%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E G+ER+R R+ E + E++R+ +RE+ ++++K ++E+EK Sbjct: 207 ERGRERERERETETETERKRQTDRER-DRQRKTEREREK 244 Score = 35.4 bits (80), Expect = 0.010 Identities = 15/40 (37%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Query: 5 KERKRGRKRERKKEKERKKER---EKGNKEKKRKKEKEKD 41 +ER R RK ER++EK+ ++ER + ++K+R++E+++D Sbjct: 230 RERDRQRKTEREREKQAERERASERETERDKERERERDRD 269 Score = 35.4 bits (80), Expect = 0.010 Identities = 13/35 (37%), Positives = 27/35 (77%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 ER+R R+RER ++ R++E + ++++ R+KE+E+ Sbjct: 368 ERERERERERDRQSAREREERERDRDRDRQKERER 402 Score = 35.0 bits (79), Expect = 0.013 Identities = 10/37 (27%), Positives = 30/37 (81%) Query: 4 GKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 G +R+R R++ER++ +E+++ + +++++R++EK++ Sbjct: 51 GDDRERNRQKERERRREKRQTERETDRKRERRREKDR 87 Score = 35.0 bits (79), Expect = 0.013 Identities = 14/40 (35%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +G +ER+R R E+++E++ +ER++ E+ R+KE+E++ Sbjct: 144 DGQRERERQRDAEKERERQTDRERQR-QTERNRQKERERE 182 Score = 35.0 bits (79), Expect = 0.013 Identities = 15/40 (37%), Positives = 26/40 (65%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E K R+ R+RER++EKE K E + ++R++E+E + Sbjct: 180 EREKNRQERRERERQREKENKTEDRHSERGRERERERETE 219 Score = 35.0 bits (79), Expect = 0.013 Identities = 12/39 (30%), Positives = 29/39 (74%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E ER+ R +ER++E++R ++R++ KE++R+ ++++ Sbjct: 249 ERASERETERDKERERERDRDRDRDRRQKERERQTDRKR 287 Score = 35.0 bits (79), Expect = 0.013 Identities = 14/37 (37%), Positives = 30/37 (81%), Gaps = 3/37 (8%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER+ RKR+R+ E++R+ ER+ +E++R++E+E++ Sbjct: 279 RERQTDRKRQRRTERDRETERK---RERQRERERERE 312 Score = 34.7 bits (78), Expect = 0.017 Identities = 15/40 (37%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+ R+R+R++EKER +++E+ +E +R+ E+ +D Sbjct: 102 EKERERQTDRERDRQREKERNRQKER-ERETEREGERGRD 140 Score = 34.7 bits (78), Expect = 0.017 Identities = 14/37 (37%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Query: 6 ERKRGRKRERKKEKERKKEREKGN-KEKKRKKEKEKD 41 +R+R R+R+ ++E+E++ ERE+ + +E +R KE+E++ Sbjct: 229 DRERDRQRKTEREREKQAERERASERETERDKERERE 265 Score = 34.7 bits (78), Expect = 0.017 Identities = 12/37 (32%), Positives = 27/37 (72%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER R+ ER KE+ER+++R++ +++++E++ D Sbjct: 248 RERASERETERDKERERERDRDRDRDRRQKERERQTD 284 Score = 34.3 bits (77), Expect = 0.022 Identities = 12/31 (38%), Positives = 24/31 (77%) Query: 11 RKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 R+R R+KE+ER++E+ + +E RK+E+ ++ Sbjct: 54 RERNRQKERERRREKRQTERETDRKRERRRE 84 Score = 34.3 bits (77), Expect = 0.022 Identities = 13/41 (31%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 E ++R+R R+++R ++++R +ER++ KE++R+ ++E+D Sbjct: 74 ETDRKRERRREKDRHRKRDRHRERQRDREKERERQTDRERD 114 Score = 34.3 bits (77), Expect = 0.022 Identities = 11/37 (29%), Positives = 28/37 (75%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 KER+R + R+ ++E+ER++E+E +++ ++ +E++ Sbjct: 177 KEREREKNRQERRERERQREKENKTEDRHSERGRERE 213 Score = 34.3 bits (77), Expect = 0.022 Identities = 12/40 (30%), Positives = 29/40 (72%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +E+ R +RER++++E++ + E + E+ R++E+E++ Sbjct: 178 EREREKNRQERRERERQREKENKTEDRHSERGRERERERE 217 Score = 34.3 bits (77), Expect = 0.022 Identities = 16/40 (40%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E ++R R ++RER+ EK+R +RE EK+R++EK+++ Sbjct: 389 ERDRDRDRQKERERQTEKDRDGQRE---TEKQREREKDRE 425 Score = 33.5 bits (75), Expect = 0.038 Identities = 17/37 (45%), Positives = 28/37 (75%), Gaps = 4/37 (10%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER R ++RER++EK R+ ERE ++KR++ +EKD Sbjct: 54 RERNRQKERERRREK-RQTERE---TDRKRERRREKD 86 Score = 33.5 bits (75), Expect = 0.038 Identities = 15/36 (41%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Query: 6 ERKRGRKRERKKEKERKKERE-KGNKEKKRKKEKEK 40 E+ R +RE +K++ER+K+RE + +E+ R++EK+K Sbjct: 405 EKDRDGQRETEKQREREKDRESERGRERGREREKQK 440 Score = 33.5 bits (75), Expect = 0.038 Identities = 13/36 (36%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +R+ ++RER+K++E ++ RE+G +E++++K +E+D Sbjct: 411 QRETEKQREREKDRESERGRERG-REREKQKGRERD 445 Score = 33.1 bits (74), Expect = 0.049 Identities = 14/40 (35%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Query: 5 KERKRGRKRERKKEKERKKEREK---GNKEKKRKKEKEKD 41 + +RGR+RER++E E + ER++ ++++RK E+E++ Sbjct: 204 RHSERGRERERERETETETERKRQTDRERDRQRKTERERE 243 Score = 33.1 bits (74), Expect = 0.049 Identities = 15/37 (40%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Query: 6 ERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 ERKR RER ++++ ++EREK +E+ ++E E+D Sbjct: 223 ERKRQTDRERDRQRKTEREREKQAERERASERETERD 259 Score = 33.1 bits (74), Expect = 0.049 Identities = 17/40 (42%), Positives = 29/40 (72%), Gaps = 2/40 (5%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E KER+R R R+R +++ R+KERE+ ++KR++ E+D Sbjct: 257 ERDKERERERDRDRDRDR-RQKERER-QTDRKRQRRTERD 294 Score = 33.1 bits (74), Expect = 0.049 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E K+R+R + RE ++ +ER +EREK K ++R +E++ D Sbjct: 413 ETEKQREREKDRESERGRERGREREK-QKGRERDRERQTD 451 Score = 32.7 bits (73), Expect = 0.065 Identities = 13/35 (37%), Positives = 25/35 (71%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKK 36 E + R+RGR+RE++K +ER +ER+ + +++K Sbjct: 425 ESERGRERGREREKQKGRERDRERQTDRQAGRQRK 459 Score = 32.3 bits (72), Expect = 0.084 Identities = 12/40 (30%), Positives = 27/40 (67%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E K+ +R R ER+ E+++++ERE+ + +++KE++ Sbjct: 241 EREKQAERERASERETERDKERERERDRDRDRDRRQKERE 280 Score = 32.3 bits (72), Expect = 0.084 Identities = 14/45 (31%), Positives = 30/45 (66%), Gaps = 9/45 (20%) Query: 6 ERKRGRKRERKKEKERKKEREKGNK---------EKKRKKEKEKD 41 ER R ++RERK++++ + +RE+ + E++R++E+E+D Sbjct: 334 ERDREKERERKRKRQTEMDRERNRQTGREGRRQAERERERERERD 378 Score = 32.3 bits (72), Expect = 0.084 Identities = 13/39 (33%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +ER++ R+ ER +E+ R++E++KG +E+ R+++ ++ Sbjct: 415 EKQREREKDRESERGRERGREREKQKG-RERDRERQTDR 452 Score = 32.0 bits (71), Expect = 0.11 Identities = 13/45 (28%), Positives = 31/45 (68%), Gaps = 5/45 (11%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-----GNKEKKRKKEKEKD 41 E ++R++ R+R+RK++ E +ER + G ++ +R++E+E++ Sbjct: 332 ETERDREKERERKRKRQTEMDRERNRQTGREGRRQAERERERERE 376 Score = 31.6 bits (70), Expect = 0.14 Identities = 15/59 (25%), Positives = 33/59 (55%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRNGFQAIRTQR 60 E ++ +R R+R+R+KE + + + +E++R++E E + T R + +T+R Sbjct: 182 EKNRQERRERERQREKENKTEDRHSERGRERERERETETETERKRQTDRERDRQRKTER 240 Score = 31.6 bits (70), Expect = 0.14 Identities = 14/48 (29%), Positives = 29/48 (60%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTP 49 E +E +RGR+R R++EK++ +ER++ + ++ + K +V P Sbjct: 421 EKDRESERGRERGREREKQKGRERDRERQTDRQAGRQRKRSTLYVNPP 468 Score = 31.2 bits (69), Expect = 0.19 Identities = 16/46 (34%), Positives = 32/46 (69%), Gaps = 6/46 (13%) Query: 2 EGGKERKRGRKRERK-KEKERKKEREK-----GNKEKKRKKEKEKD 41 E +ER R R R+R+ KE+ER+ +R++ ++E +RK+E++++ Sbjct: 261 ERERERDRDRDRDRRQKERERQTDRKRQRRTERDRETERKRERQRE 306 Score = 30.8 bits (68), Expect = 0.25 Identities = 13/39 (33%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E +E +RGR R+ ++ER+++R+ KE++R+ ++E+ Sbjct: 130 ETEREGERGRDRQTDGQRERERQRD-AEKERERQTDRER 167 Score = 30.8 bits (68), Expect = 0.25 Identities = 9/39 (23%), Positives = 29/39 (74%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E + +R +R++++E+ER ++R++ ++K+R+++ ++ Sbjct: 247 ERERASERETERDKERERERDRDRDRDRRQKERERQTDR 285 Score = 29.3 bits (64), Expect = 0.71 Identities = 10/35 (28%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Query: 7 RKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 R++ R+R+ ++++R+ ER++ E+KR++++E++ Sbjct: 275 RQKERERQTDRKRQRRTERDR-ETERKRERQRERE 308 Score = 26.2 bits (56), Expect = 6.0 Identities = 12/37 (32%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER+ R+ ER ++++ +RE +E++R EKE++ Sbjct: 127 RERETEREGERGRDRQTDGQRE---RERQRDAEKERE 160 >gi|167614488 TBC1 domain family, member 10B [Homo sapiens] Length = 808 Score = 43.5 bits (101), Expect = 4e-05 Identities = 21/41 (51%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEK-KRKKEKEKDHLE 44 KER++ K +K+EKER+KER+K KE+ K++KE+EK E Sbjct: 726 KERQKQEKERQKQEKEREKERQKQEKEREKQEKEREKQEKE 766 Score = 37.7 bits (86), Expect = 0.002 Identities = 14/40 (35%), Positives = 31/40 (77%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E K+ K +K+E+++EKER+K+ ++ K++K ++++EK+ Sbjct: 727 ERQKQEKERQKQEKEREKERQKQEKEREKQEKEREKQEKE 766 Score = 36.6 bits (83), Expect = 0.004 Identities = 17/41 (41%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEK-KRKKEKEKDHLE 44 KE ++ K +K+EKER+K+ ++ KE+ K++KE+EK E Sbjct: 719 KETRKQEKERQKQEKERQKQEKEREKERQKQEKEREKQEKE 759 Score = 36.2 bits (82), Expect = 0.006 Identities = 13/34 (38%), Positives = 29/34 (85%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEK 38 KER++ R+++ K+ ++++KEREK KE++++++K Sbjct: 740 KEREKERQKQEKEREKQEKEREKQEKERQKQEKK 773 Score = 35.8 bits (81), Expect = 0.008 Identities = 17/40 (42%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKER-KKEREKGNKEKKRKKEKEK 40 E K+ K K +K+EKER K+E+E+ +EK+R+K+++K Sbjct: 734 ERQKQEKEREKERQKQEKEREKQEKEREKQEKERQKQEKK 773 Score = 33.5 bits (75), Expect = 0.038 Identities = 18/38 (47%), Positives = 33/38 (86%), Gaps = 3/38 (7%) Query: 5 KERKRGRKRERKKEKER-KKEREKGNKEK-KRKKEKEK 40 KER++ +++ER+KE+++ +KEREK KE+ K++KE++K Sbjct: 733 KERQK-QEKEREKERQKQEKEREKQEKEREKQEKERQK 769 Score = 32.7 bits (73), Expect = 0.065 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Query: 2 EGGKERKRGRKRERKKEKER-KKEREKGNKEKKRKKEK 38 E KER++ K K+EKER K+E+E+ +EKK + K Sbjct: 741 EREKERQKQEKEREKQEKEREKQEKERQKQEKKAQGRK 778 Score = 30.0 bits (66), Expect = 0.42 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Query: 5 KERKRGRKRERKKEKERKKEREK--GNKEKKRKK 36 KER++ K K+EKER+K+ +K G K R+K Sbjct: 751 KEREKQEKEREKQEKERQKQEKKAQGRKLSLRRK 784 >gi|197333879 genetic suppressor element 1 isoform 2 [Homo sapiens] Length = 1113 Score = 43.5 bits (101), Expect = 4e-05 Identities = 19/37 (51%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER+R R+RER+ ++ER+KERE+ +EK+R++EKE++ Sbjct: 237 REREREREREREADREREKERER-EREKEREQEKERE 272 Score = 43.1 bits (100), Expect = 5e-05 Identities = 20/41 (48%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E +ER+R R+ +R++EKER++EREK +EK+R++EKE++ Sbjct: 238 EREREREREREADREREKEREREREKEREQEKEREREKERE 278 Score = 43.1 bits (100), Expect = 5e-05 Identities = 19/40 (47%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+ R+RE+++E+ER+KERE+ KE++R+KE+E++ Sbjct: 242 EREREREADREREKEREREREKEREQ-EKEREREKERERE 280 Score = 42.4 bits (98), Expect = 8e-05 Identities = 18/40 (45%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER++ R+RER+KE+E++KERE+ KE++R+ E++++ Sbjct: 248 EADREREKEREREREKEREQEKERER-EKERERELERQRE 286 Score = 40.4 bits (93), Expect = 3e-04 Identities = 17/42 (40%), Positives = 33/42 (78%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHL 43 E +ER+R ++RE++KE+ER+KERE+ + ++ ++ +EK+ L Sbjct: 254 EKEREREREKEREQEKEREREKERERELERQREQRAREKELL 295 Score = 40.0 bits (92), Expect = 4e-04 Identities = 17/37 (45%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +E +R R+RER++E+ER+ +RE+ KE++R++EKE++ Sbjct: 231 EELRREREREREREREREADRER-EKEREREREKERE 266 Score = 39.7 bits (91), Expect = 5e-04 Identities = 17/40 (42%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R R+RE +E+E+++ERE+ KE++++KE+E++ Sbjct: 236 EREREREREREREADREREKERERER-EKEREQEKERERE 274 Score = 39.3 bits (90), Expect = 7e-04 Identities = 18/41 (43%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 M+ R+R R+RER++E+E +EREK +E++R+KE+E++ Sbjct: 229 MDEELRREREREREREREREADREREK-EREREREKEREQE 268 Score = 38.1 bits (87), Expect = 0.002 Identities = 14/40 (35%), Positives = 33/40 (82%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E KER+R R++ER++EKER++E+E+ + +++++++ ++ Sbjct: 252 EREKEREREREKEREQEKEREREKERERELERQREQRARE 291 Score = 30.0 bits (66), Expect = 0.42 Identities = 15/42 (35%), Positives = 25/42 (59%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHL 43 E +E++R R++ER++E ER++E+ KE K E L Sbjct: 264 EREQEKEREREKERERELERQREQRAREKELLAAKALEPSFL 305 >gi|44955926 genetic suppressor element 1 isoform 1 [Homo sapiens] Length = 1217 Score = 43.5 bits (101), Expect = 4e-05 Identities = 19/37 (51%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER+R R+RER+ ++ER+KERE+ +EK+R++EKE++ Sbjct: 341 REREREREREREADREREKERER-EREKEREQEKERE 376 Score = 43.1 bits (100), Expect = 5e-05 Identities = 20/41 (48%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E +ER+R R+ +R++EKER++EREK +EK+R++EKE++ Sbjct: 342 EREREREREREADREREKEREREREKEREQEKEREREKERE 382 Score = 43.1 bits (100), Expect = 5e-05 Identities = 19/40 (47%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+ R+RE+++E+ER+KERE+ KE++R+KE+E++ Sbjct: 346 EREREREADREREKEREREREKEREQ-EKEREREKERERE 384 Score = 42.4 bits (98), Expect = 8e-05 Identities = 18/40 (45%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER++ R+RER+KE+E++KERE+ KE++R+ E++++ Sbjct: 352 EADREREKEREREREKEREQEKERER-EKERERELERQRE 390 Score = 40.4 bits (93), Expect = 3e-04 Identities = 17/42 (40%), Positives = 33/42 (78%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHL 43 E +ER+R ++RE++KE+ER+KERE+ + ++ ++ +EK+ L Sbjct: 358 EKEREREREKEREQEKEREREKERERELERQREQRAREKELL 399 Score = 40.0 bits (92), Expect = 4e-04 Identities = 17/37 (45%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +E +R R+RER++E+ER+ +RE+ KE++R++EKE++ Sbjct: 335 EELRREREREREREREREADRER-EKEREREREKERE 370 Score = 39.7 bits (91), Expect = 5e-04 Identities = 17/40 (42%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R R+RE +E+E+++ERE+ KE++++KE+E++ Sbjct: 340 EREREREREREREADREREKERERER-EKEREQEKERERE 378 Score = 39.3 bits (90), Expect = 7e-04 Identities = 18/41 (43%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 M+ R+R R+RER++E+E +EREK +E++R+KE+E++ Sbjct: 333 MDEELRREREREREREREREADREREK-EREREREKEREQE 372 Score = 38.1 bits (87), Expect = 0.002 Identities = 14/40 (35%), Positives = 33/40 (82%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E KER+R R++ER++EKER++E+E+ + +++++++ ++ Sbjct: 356 EREKEREREREKEREQEKEREREKERERELERQREQRARE 395 Score = 30.0 bits (66), Expect = 0.42 Identities = 15/42 (35%), Positives = 25/42 (59%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHL 43 E +E++R R++ER++E ER++E+ KE K E L Sbjct: 368 EREQEKEREREKERERELERQREQRAREKELLAAKALEPSFL 409 >gi|68509926 DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Homo sapiens] Length = 795 Score = 43.5 bits (101), Expect = 4e-05 Identities = 19/38 (50%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Query: 4 GKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 GK+R R R RE + K+R +ER++G++E++R+KEKEK+ Sbjct: 24 GKDRDRDRDRE-DRSKDRDRERDRGDREREREKEKEKE 60 >gi|239752449 PREDICTED: hypothetical protein [Homo sapiens] Length = 170 Score = 43.1 bits (100), Expect = 5e-05 Identities = 16/36 (44%), Positives = 32/36 (88%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +E K+ +++E+KK+K++KK+++K K+KK+KK+K+K Sbjct: 102 REEKKEKEKEKKKKKKKKKKKKKKKKKKKKKKKKKK 137 Score = 42.7 bits (99), Expect = 6e-05 Identities = 16/39 (41%), Positives = 34/39 (87%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E KE+++ +K+++KK+K++KK+++K K+KK+KK+K++ Sbjct: 103 EEKKEKEKEKKKKKKKKKKKKKKKKKKKKKKKKKKKKKR 141 Score = 42.0 bits (97), Expect = 1e-04 Identities = 15/39 (38%), Positives = 34/39 (87%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E KE+K+ +K+++KK+K++KK+++K K+KK+K+++++ Sbjct: 107 EKEKEKKKKKKKKKKKKKKKKKKKKKKKKKKKKKRKRKR 145 Score = 42.0 bits (97), Expect = 1e-04 Identities = 15/36 (41%), Positives = 32/36 (88%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K+RK++R++ K KK++K+K+K Sbjct: 125 KKKKKKKKKKKKKKKKRKRKRKRKRKRKKKRKKKKK 160 Score = 41.6 bits (96), Expect = 1e-04 Identities = 15/39 (38%), Positives = 34/39 (87%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E K++K+ +K+++KK+K++KK+++K K+KKRK+++++ Sbjct: 109 EKEKKKKKKKKKKKKKKKKKKKKKKKKKKKKKRKRKRKR 147 Score = 41.2 bits (95), Expect = 2e-04 Identities = 15/36 (41%), Positives = 30/36 (83%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K ++K + K ++KKRKK+K+K Sbjct: 126 KKKKKKKKKKKKKKKRKRKRKRKRKRKKKRKKKKKK 161 Score = 40.8 bits (94), Expect = 2e-04 Identities = 16/33 (48%), Positives = 29/33 (87%) Query: 8 KRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +R K+E++KEK++KK+++K K+KK+KK+K+K Sbjct: 101 QREEKKEKEKEKKKKKKKKKKKKKKKKKKKKKK 133 Score = 40.4 bits (93), Expect = 3e-04 Identities = 15/40 (37%), Positives = 33/40 (82%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 + G +R+ +++E++K+K++KK+++K K+KK+KK+K+K Sbjct: 96 LHGLPQREEKKEKEKEKKKKKKKKKKKKKKKKKKKKKKKK 135 Score = 40.4 bits (93), Expect = 3e-04 Identities = 16/39 (41%), Positives = 31/39 (79%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E ++ K +K+++KK+K++KK+++K K+KK+KK+K K Sbjct: 104 EKKEKEKEKKKKKKKKKKKKKKKKKKKKKKKKKKKKKRK 142 Score = 40.4 bits (93), Expect = 3e-04 Identities = 14/39 (35%), Positives = 34/39 (87%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E K++K+ +K+++KK+K++KK+++K K++KRK+++++ Sbjct: 111 EKKKKKKKKKKKKKKKKKKKKKKKKKKKKKRKRKRKRKR 149 Score = 40.4 bits (93), Expect = 3e-04 Identities = 14/36 (38%), Positives = 31/36 (86%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K++KK+R++ K K+++K+K K Sbjct: 121 KKKKKKKKKKKKKKKKKKKKRKRKRKRKRKRKKKRK 156 Score = 40.4 bits (93), Expect = 3e-04 Identities = 14/36 (38%), Positives = 31/36 (86%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K++KK + K +++KRKK+++K Sbjct: 122 KKKKKKKKKKKKKKKKKKKRKRKRKRKRKRKKKRKK 157 Score = 40.4 bits (93), Expect = 3e-04 Identities = 14/36 (38%), Positives = 31/36 (86%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K++K++R++ K K++KK K+K Sbjct: 123 KKKKKKKKKKKKKKKKKKRKRKRKRKRKRKKKRKKK 158 Score = 40.0 bits (92), Expect = 4e-04 Identities = 14/36 (38%), Positives = 30/36 (83%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K++KK+++K K K+++K K K Sbjct: 115 KKKKKKKKKKKKKKKKKKKKKKKKKKRKRKRKRKRK 150 Score = 40.0 bits (92), Expect = 4e-04 Identities = 14/36 (38%), Positives = 30/36 (83%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K++KK+++K K K+++K K K Sbjct: 117 KKKKKKKKKKKKKKKKKKKKKKKKRKRKRKRKRKRK 152 Score = 40.0 bits (92), Expect = 4e-04 Identities = 13/36 (36%), Positives = 33/36 (91%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K++KK+++K +++KRK++++K Sbjct: 118 KKKKKKKKKKKKKKKKKKKKKKKRKRKRKRKRKRKK 153 Score = 39.7 bits (91), Expect = 5e-04 Identities = 13/36 (36%), Positives = 32/36 (88%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K++KK++ K +++KRK++K++ Sbjct: 120 KKKKKKKKKKKKKKKKKKKKKRKRKRKRKRKRKKKR 155 Score = 39.3 bits (90), Expect = 7e-04 Identities = 13/36 (36%), Positives = 31/36 (86%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K++KK++++ K K+++K K+K Sbjct: 119 KKKKKKKKKKKKKKKKKKKKKKRKRKRKRKRKRKKK 154 Score = 38.9 bits (89), Expect = 0.001 Identities = 12/36 (33%), Positives = 33/36 (91%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K++KK+++K +++KRK+++++ Sbjct: 116 KKKKKKKKKKKKKKKKKKKKKKKKKRKRKRKRKRKR 151 Score = 38.1 bits (87), Expect = 0.002 Identities = 12/36 (33%), Positives = 31/36 (86%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K++K+ +K+++KK+K+++K + K +++K+K++K+K Sbjct: 124 KKKKKKKKKKKKKKKKKRKRKRKRKRKRKKKRKKKK 159 Score = 37.7 bits (86), Expect = 0.002 Identities = 14/35 (40%), Positives = 29/35 (82%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKE 39 K++K+ +K++RK++++RK++R+K K+KK+K E Sbjct: 131 KKKKKKKKKKRKRKRKRKRKRKKKRKKKKKKTGNE 165 Score = 36.6 bits (83), Expect = 0.004 Identities = 14/38 (36%), Positives = 29/38 (76%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDH 42 K++K+ +KR+RK++++RK+++++ K+KK E K H Sbjct: 133 KKKKKKKKRKRKRKRKRKRKKKRKKKKKKTGNEGAKIH 170 >gi|239747891 PREDICTED: hypothetical protein [Homo sapiens] Length = 202 Score = 42.7 bits (99), Expect = 6e-05 Identities = 19/42 (45%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Query: 5 KERKRGRKRERKKEKERKKER--EKGNKEKKRKKEKEKDHLE 44 +ER+R R+RERK+E +R+++R E+ ++K+RKKE++K+ E Sbjct: 140 RERERQRQRERKRETDRERQRWAEREERKKERKKERKKERKE 181 Score = 42.4 bits (98), Expect = 8e-05 Identities = 16/45 (35%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKDHLEW 45 +GG+ER + +RER +E+ER+++RE+ ++++RK+E +++ W Sbjct: 117 KGGRERDKQTERERDRERERQRQRERERQRQRERKRETDRERQRW 161 Score = 42.4 bits (98), Expect = 8e-05 Identities = 18/31 (58%), Positives = 26/31 (83%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRK 35 +ERK+ RK+ERKKE++ KK+ EK ++KKRK Sbjct: 165 EERKKERKKERKKERKEKKKEEKRREDKKRK 195 Score = 41.6 bits (96), Expect = 1e-04 Identities = 20/40 (50%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R +RE +K KERKKER+K KEKK+++++ +D Sbjct: 153 ETDRERQRWAEREERK-KERKKERKKERKEKKKEEKRRED 191 Score = 40.4 bits (93), Expect = 3e-04 Identities = 17/39 (43%), Positives = 30/39 (76%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 E ++R+R RKRE +E++R ERE+ KE+K++++KE+ Sbjct: 141 ERERQRQRERKRETDRERQRWAEREERKKERKKERKKER 179 Score = 39.3 bits (90), Expect = 7e-04 Identities = 17/38 (44%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKER-EKGNKEKKRKKEKEKD 41 +ER + R RERK+E +R +ER KG +E+ ++ E+E+D Sbjct: 94 RERDKDRDRERKRETDRNRERNRKGGRERDKQTERERD 131 Score = 38.9 bits (89), Expect = 0.001 Identities = 18/41 (43%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E KER R R+RER+ E+E +++RE+ +E+KR+ ++E+D Sbjct: 57 ERQKERDRQRQRERETERETERQRERQRQRERKRQTDRERD 97 Score = 38.9 bits (89), Expect = 0.001 Identities = 17/41 (41%), Positives = 33/41 (80%), Gaps = 4/41 (9%) Query: 5 KERKRGRKRERKKEKERKKE----REKGNKEKKRKKEKEKD 41 +ER+R R+RER++++ERK+E R++ + ++RKKE++K+ Sbjct: 134 RERQRQRERERQRQRERKRETDRERQRWAEREERKKERKKE 174 Score = 37.0 bits (84), Expect = 0.003 Identities = 17/38 (44%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 +ERKR RER K+++R+++RE N+E+ RK +E+D Sbjct: 86 RERKRQTDRERDKDRDRERKRETDRNRERNRKGGRERD 123 Score = 36.6 bits (83), Expect = 0.004 Identities = 15/37 (40%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 + R+R R RER ++ +R+KERE+ KE+ R++++E++ Sbjct: 36 RHRQRDRHRERDRQTDREKERER-QKERDRQRQRERE 71 Score = 36.2 bits (82), Expect = 0.006 Identities = 14/41 (34%), Positives = 28/41 (68%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ME +ERKR R ++ E+ER ++RE+ N+ ++ + +++D Sbjct: 1 MERQRERKRETDRGKETERERDRQRERENQTERENRHRQRD 41 Score = 35.4 bits (80), Expect = 0.010 Identities = 14/37 (37%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 + R+R R+ +R+KE+ER+KER++ ++++R+ E+E + Sbjct: 42 RHRERDRQTDREKERERQKERDR-QRQRERETERETE 77 Score = 34.3 bits (77), Expect = 0.022 Identities = 14/40 (35%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +E +R R+R+R++E++R+ +RE+ +K++ R++++E D Sbjct: 71 ETERETERQRERQRQRERKRQTDRER-DKDRDRERKRETD 109 Score = 34.3 bits (77), Expect = 0.022 Identities = 12/40 (30%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E ++R+R R+RERK++ +R++++++ ++E+KR+ ++ ++ Sbjct: 75 ETERQRERQRQRERKRQTDRERDKDR-DRERKRETDRNRE 113 Score = 33.9 bits (76), Expect = 0.029 Identities = 12/37 (32%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ++R R R+R+R+ ++E+++ER+K ++++R++E+E + Sbjct: 38 RQRDRHRERDRQTDREKERERQK-ERDRQRQRERETE 73 Score = 33.5 bits (75), Expect = 0.038 Identities = 17/41 (41%), Positives = 30/41 (73%), Gaps = 5/41 (12%) Query: 2 EGGKERKRGRK--RERKKEKERKKEREKGNKEKKRKKEKEK 40 E + R+R RK RER K+ ER+++RE +E++R++E+E+ Sbjct: 107 ETDRNRERNRKGGRERDKQTERERDRE---RERQRQRERER 144 Score = 33.1 bits (74), Expect = 0.049 Identities = 13/40 (32%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEK 40 E ++ R ++RER+KE++R+++RE+ +E +R++E+++ Sbjct: 45 ERDRQTDREKERERQKERDRQRQRERETERETERQRERQR 84 Score = 32.7 bits (73), Expect = 0.065 Identities = 11/38 (28%), Positives = 26/38 (68%) Query: 4 GKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 GKE +R R R+R++E + ++E +++ R+++++ D Sbjct: 14 GKETERERDRQRERENQTERENRHRQRDRHRERDRQTD 51 Score = 32.7 bits (73), Expect = 0.065 Identities = 17/48 (35%), Positives = 33/48 (68%), Gaps = 8/48 (16%) Query: 2 EGGKERKRGRKRE-------RKKEKERKKEREK-GNKEKKRKKEKEKD 41 E +ER R R+RE R ++++R +ER++ ++EK+R+++KE+D Sbjct: 16 ETERERDRQRERENQTERENRHRQRDRHRERDRQTDREKERERQKERD 63 Score = 32.7 bits (73), Expect = 0.065 Identities = 12/37 (32%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ++R R R R+ +EKER++++E+ +++++R++E E++ Sbjct: 40 RDRHRERDRQTDREKERERQKER-DRQRQRERETERE 75 Score = 32.7 bits (73), Expect = 0.065 Identities = 15/47 (31%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTPRN 51 +ER+ R+ ER++E++R++ER+ ++ R+++K++D T RN Sbjct: 68 RERETERETERQRERQRQRERK---RQTDRERDKDRDRERKRETDRN 111 Score = 32.3 bits (72), Expect = 0.084 Identities = 17/42 (40%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Query: 2 EGGKERKRGRKRE--RKKEKERKKEREKGNKEKKRKKEKEKD 41 E K+R R RKRE R +E+ RK RE+ +K+ +R++++E++ Sbjct: 95 ERDKDRDRERKRETDRNRERNRKGGRER-DKQTERERDRERE 135 Score = 31.6 bits (70), Expect = 0.14 Identities = 13/36 (36%), Positives = 27/36 (75%), Gaps = 3/36 (8%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 + R R+R+R +E++R+ +REK E++R+KE+++ Sbjct: 32 ERENRHRQRDRHRERDRQTDREK---ERERQKERDR 64 Score = 31.6 bits (70), Expect = 0.14 Identities = 14/41 (34%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEKD 41 E +E R R+R RK +ER K+ E+ ++E++R++++E++ Sbjct: 103 ERKRETDRNRERNRKGGRERDKQTERERDRERERQRQRERE 143 Score = 28.9 bits (63), Expect = 0.93 Identities = 10/36 (27%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +ER R RE+++E++++++R++ +E++ ++E E+ Sbjct: 44 RERDRQTDREKERERQKERDRQR-QRERETERETER 78 >gi|31377595 zinc finger CCCH-type containing 18 [Homo sapiens] Length = 953 Score = 42.7 bits (99), Expect = 6e-05 Identities = 19/41 (46%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Query: 2 EGGKERKR-GRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R R+RER++E+ER +ERE+ +E++R++E E+D Sbjct: 403 ERERERERENRQRERERERERDRERERRQREREREREHERD 443 Score = 41.6 bits (96), Expect = 1e-04 Identities = 16/39 (41%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Query: 5 KERKRGRKRE-RKKEKERKKEREKGNKEKKRKKEKEKDH 42 +ER+R R+RE R++E+ER++ER++ + ++R++E+E++H Sbjct: 402 RERERERERENRQRERERERERDRERERRQREREREREH 440 Score = 39.7 bits (91), Expect = 5e-04 Identities = 15/41 (36%), Positives = 29/41 (70%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEW 45 ++R+R R+RER +E+ER++ + +E +R KE+++ EW Sbjct: 413 RQRERERERERDRERERRQREREREREHERDKERQRRKEEW 453 Score = 39.7 bits (91), Expect = 5e-04 Identities = 13/38 (34%), Positives = 30/38 (78%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDH 42 ++R+R R+RE +++KER++ +E+ +E+ ++ EK++ H Sbjct: 430 RQREREREREHERDKERQRRKEEWERERAKRDEKDRQH 467 Score = 38.5 bits (88), Expect = 0.001 Identities = 17/41 (41%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERK-KEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+R R+RER+ +E+ER++E E+ + ++RK+E E++ Sbjct: 416 ERERERERDRERERRQREREREREHERDKERQRRKEEWERE 456 Score = 37.7 bits (86), Expect = 0.002 Identities = 16/41 (39%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Query: 2 EGGKERK-RGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +ER+ R R+RER++E++R++ER + +E++R+ E++K+ Sbjct: 405 ERERERENRQRERERERERDRERERRQREREREREHERDKE 445 Score = 37.0 bits (84), Expect = 0.003 Identities = 15/37 (40%), Positives = 27/37 (72%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 + R+R R+RER+ E++++++R K E++R K EKD Sbjct: 428 ERRQREREREREHERDKERQRRKEEWERERAKRDEKD 464 Score = 35.8 bits (81), Expect = 0.008 Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 11/48 (22%) Query: 5 KERKRGRKRERKKEKERKKE---REKGNKEKK--------RKKEKEKD 41 +ER+R R+ ER KE++R+KE RE+ +++K R+KE+EK+ Sbjct: 432 REREREREHERDKERQRRKEEWERERAKRDEKDRQHRDRDREKEREKE 479 Score = 35.0 bits (79), Expect = 0.013 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 3/53 (5%) Query: 2 EGGKERKRGRKRERKKE---KERKKEREKGNKEKKRKKEKEKDHLEWVVTPRN 51 E +E +R ++R+R+KE +ER K EK + + R +EKE++ + PR+ Sbjct: 435 EREREHERDKERQRRKEEWERERAKRDEKDRQHRDRDREKEREKEKGKPKPRS 487 Score = 30.4 bits (67), Expect = 0.32 Identities = 11/32 (34%), Positives = 23/32 (71%) Query: 13 RERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 RER++E+ER+ + + +E++R +E+E+ E Sbjct: 402 RERERERERENRQRERERERERDRERERRQRE 433 Score = 26.2 bits (56), Expect = 6.0 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 5 KERK-RGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K+R+ R R RE+++EKE+ K + + + R+ E K Sbjct: 463 KDRQHRDRDREKEREKEKGKPKPRSPQPPSRQAEPPK 499 >gi|207113164 Treacher Collins-Franceschetti syndrome 1 isoform f [Homo sapiens] Length = 1412 Score = 42.4 bits (98), Expect = 8e-05 Identities = 19/41 (46%), Positives = 27/41 (65%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +EGG + K+E+KK +RKK++EK K+KK KK KD Sbjct: 1352 VEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKD 1392 Score = 32.7 bits (73), Expect = 0.065 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 7/43 (16%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEK-------KRKKEKEK 40 KE+K+ KR++ KEK+ KK++ K K K+KK+K+K Sbjct: 1364 KEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKKKK 1406 >gi|207113162 Treacher Collins-Franceschetti syndrome 1 isoform e [Homo sapiens] Length = 1451 Score = 42.4 bits (98), Expect = 8e-05 Identities = 19/41 (46%), Positives = 27/41 (65%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +EGG + K+E+KK +RKK++EK K+KK KK KD Sbjct: 1391 VEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKD 1431 Score = 32.7 bits (73), Expect = 0.065 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 7/43 (16%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEK-------KRKKEKEK 40 KE+K+ KR++ KEK+ KK++ K K K+KK+K+K Sbjct: 1403 KEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKKKK 1445 >gi|207113160 Treacher Collins-Franceschetti syndrome 1 isoform d [Homo sapiens] Length = 1488 Score = 42.4 bits (98), Expect = 8e-05 Identities = 19/41 (46%), Positives = 27/41 (65%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +EGG + K+E+KK +RKK++EK K+KK KK KD Sbjct: 1428 VEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKD 1468 Score = 32.7 bits (73), Expect = 0.065 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 7/43 (16%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEK-------KRKKEKEK 40 KE+K+ KR++ KEK+ KK++ K K K+KK+K+K Sbjct: 1440 KEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKKKK 1482 >gi|57164975 Treacher Collins-Franceschetti syndrome 1 isoform b [Homo sapiens] Length = 1411 Score = 42.4 bits (98), Expect = 8e-05 Identities = 19/41 (46%), Positives = 27/41 (65%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +EGG + K+E+KK +RKK++EK K+KK KK KD Sbjct: 1351 VEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKD 1391 Score = 32.7 bits (73), Expect = 0.065 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 7/43 (16%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEK-------KRKKEKEK 40 KE+K+ KR++ KEK+ KK++ K K K+KK+K+K Sbjct: 1363 KEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKKKK 1405 >gi|57164977 Treacher Collins-Franceschetti syndrome 1 isoform a [Homo sapiens] Length = 1450 Score = 42.4 bits (98), Expect = 8e-05 Identities = 19/41 (46%), Positives = 27/41 (65%) Query: 1 MEGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +EGG + K+E+KK +RKK++EK K+KK KK KD Sbjct: 1390 VEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKD 1430 Score = 32.7 bits (73), Expect = 0.065 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 7/43 (16%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEK-------KRKKEKEK 40 KE+K+ KR++ KEK+ KK++ K K K+KK+K+K Sbjct: 1402 KEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKKKK 1444 >gi|117553580 adaptor-related protein complex 3, delta 1 subunit isoform 2 [Homo sapiens] Length = 1153 Score = 42.0 bits (97), Expect = 1e-04 Identities = 17/37 (45%), Positives = 29/37 (78%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K+ K+ +++ER KEK+++KE++K K KK+K KEK+ Sbjct: 846 KKEKKHKEKERDKEKKKEKEKKKSPKPKKKKHRKEKE 882 Score = 39.7 bits (91), Expect = 5e-04 Identities = 19/39 (48%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Query: 5 KERKRGRKRERK-KEKERKKEREKGNKEKKRKKEKEKDH 42 K+ K+ +K+E+K KEKER KE++K ++KK K K+K H Sbjct: 839 KKSKKPKKKEKKHKEKERDKEKKKEKEKKKSPKPKKKKH 877 Score = 36.2 bits (82), Expect = 0.006 Identities = 16/39 (41%), Positives = 29/39 (74%), Gaps = 4/39 (10%) Query: 6 ERKRGRKRERKKEKERKKEREKGN----KEKKRKKEKEK 40 ++K + +E++++KE+KKE+EK K+KK +KEKE+ Sbjct: 845 KKKEKKHKEKERDKEKKKEKEKKKSPKPKKKKHRKEKEE 883 Score = 33.9 bits (76), Expect = 0.029 Identities = 13/31 (41%), Positives = 23/31 (74%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRK 35 KE+K+ K ++KK ++ K+ER KG K+ K++ Sbjct: 864 KEKKKSPKPKKKKHRKEKEERTKGKKKSKKQ 894 Score = 32.7 bits (73), Expect = 0.065 Identities = 13/36 (36%), Positives = 26/36 (72%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 KER + +K+E++K+K K +++K KEK+ + + +K Sbjct: 854 KERDKEKKKEKEKKKSPKPKKKKHRKEKEERTKGKK 889 Score = 32.0 bits (71), Expect = 0.11 Identities = 12/28 (42%), Positives = 22/28 (78%) Query: 14 ERKKEKERKKEREKGNKEKKRKKEKEKD 41 E+K +K +KKE++ KE+ ++K+KEK+ Sbjct: 838 EKKSKKPKKKEKKHKEKERDKEKKKEKE 865 Score = 31.2 bits (69), Expect = 0.19 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 11/45 (24%) Query: 5 KERKRGRKRERKKEKERK-----------KEREKGNKEKKRKKEK 38 K +++ R +E+KKEKE+K KE+E+ K KK+ K++ Sbjct: 850 KHKEKERDKEKKKEKEKKKSPKPKKKKHRKEKEERTKGKKKSKKQ 894 Score = 30.0 bits (66), Expect = 0.42 Identities = 12/25 (48%), Positives = 19/25 (76%) Query: 17 KEKERKKEREKGNKEKKRKKEKEKD 41 K +E ++ R+K K+K+RKK KEK+ Sbjct: 726 KLEEERRHRQKLEKDKRRKKRKEKE 750 Score = 30.0 bits (66), Expect = 0.42 Identities = 13/36 (36%), Positives = 24/36 (66%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKE 37 E KE+++ + + KK+K RK++ E+ +KK KK+ Sbjct: 859 EKKKEKEKKKSPKPKKKKHRKEKEERTKGKKKSKKQ 894 Score = 29.6 bits (65), Expect = 0.55 Identities = 12/37 (32%), Positives = 22/37 (59%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +ER+ +K E+ K ++++KE+EK K + E D Sbjct: 729 EERRHRQKLEKDKRRKKRKEKEKKGKRRHSSLPTESD 765 Score = 29.3 bits (64), Expect = 0.71 Identities = 12/29 (41%), Positives = 20/29 (68%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKR 34 E +R +++ +K+K RKK +EK K K+R Sbjct: 728 EEERRHRQKLEKDKRRKKRKEKEKKGKRR 756 Score = 28.9 bits (63), Expect = 0.93 Identities = 10/38 (26%), Positives = 27/38 (71%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKE 39 E +++++ +++E+KK + KK++ + KE++ K +K+ Sbjct: 853 EKERDKEKKKEKEKKKSPKPKKKKHRKEKEERTKGKKK 890 Score = 26.2 bits (56), Expect = 6.0 Identities = 12/36 (33%), Positives = 21/36 (58%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKE 37 E K K +K+ RK+++ER K ++K K+ +E Sbjct: 865 EKKKSPKPKKKKHRKEKEERTKGKKKSKKQPPGSEE 900 >gi|7662238 apoptotic chromatin condensation inducer 1 [Homo sapiens] Length = 1341 Score = 41.2 bits (95), Expect = 2e-04 Identities = 13/36 (36%), Positives = 31/36 (86%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 +E++R RER +E+ER++ER++G++++ R++++E+ Sbjct: 1277 REKRREHSRERDRERERERERDRGDRDRDRERDRER 1312 Score = 36.2 bits (82), Expect = 0.006 Identities = 16/41 (39%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKG-NKEKKRKKEKEKD 41 E KER++ +RER ++ ER+K RE ++++R++E+E+D Sbjct: 1258 EEQKEREKEAERERNRQLEREKRREHSRERDRERERERERD 1298 Score = 34.7 bits (78), Expect = 0.017 Identities = 11/36 (30%), Positives = 28/36 (77%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 ER++ R+ R++++ER++ERE+ ++ R +E++++ Sbjct: 1276 EREKRREHSRERDRERERERERDRGDRDRDRERDRE 1311 Score = 34.3 bits (77), Expect = 0.022 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 6/46 (13%) Query: 2 EGGKERKRGRK---RERKKEKERKKEREKG---NKEKKRKKEKEKD 41 E KER++ RK E +KE+E++ ERE+ +EK+R+ +E+D Sbjct: 1243 ERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERD 1288 Score = 33.9 bits (76), Expect = 0.029 Identities = 12/40 (30%), Positives = 27/40 (67%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E ++ +R ++RE +E++R++ERE+ R +++E+D Sbjct: 1270 ERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERD 1309 Score = 33.5 bits (75), Expect = 0.038 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREK-GNKEKKRKKEKEK 40 E + K KR +++E+E +KEREK +E+ R+ E+EK Sbjct: 1240 ERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREK 1279 Score = 33.1 bits (74), Expect = 0.049 Identities = 11/35 (31%), Positives = 26/35 (74%) Query: 7 RKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 +K + ER KE+E++++ ++ ++K+R+KE E++ Sbjct: 1236 QKEAERAERAKEREKRRKEQEEEEQKEREKEAERE 1270 Score = 33.1 bits (74), Expect = 0.049 Identities = 14/40 (35%), Positives = 26/40 (65%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 E +E R R RER++E+ER + ++E+ R++ +E+D Sbjct: 1278 EKRREHSRERDRERERERERDRGDRDRDRERDRERGRERD 1317 Score = 31.2 bits (69), Expect = 0.19 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 K R+ R R R +++ R+KER K ++K KKEK ++ Sbjct: 1169 KVREGPRSRSRSRDR-RRKERAKSKEKKSEKKEKAQE 1204 Score = 30.8 bits (68), Expect = 0.25 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 EG + R R R R R+KE+ + KE++ KEK +++ K Sbjct: 1172 EGPRSRSRSRDR-RRKERAKSKEKKSEKKEKAQEEPPAK 1209 Score = 30.4 bits (67), Expect = 0.32 Identities = 13/42 (30%), Positives = 28/42 (66%), Gaps = 5/42 (11%) Query: 2 EGGKERKRGRKRERK-----KEKERKKEREKGNKEKKRKKEK 38 E +ER R R+RER+ ++++R+++RE+G + +R ++ Sbjct: 1282 EHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKR 1323 Score = 28.9 bits (63), Expect = 0.93 Identities = 12/39 (30%), Positives = 23/39 (58%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 ER+ R + R+ + R + R++ KE+ + KEK+ + E Sbjct: 1162 EREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKE 1200 Score = 28.9 bits (63), Expect = 0.93 Identities = 10/34 (29%), Positives = 24/34 (70%) Query: 7 RKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 R+R R+RER++E++R ++++R +E+++ Sbjct: 1285 RERDRERERERERDRGDRDRDRERDRERGRERDR 1318 Score = 26.2 bits (56), Expect = 6.0 Identities = 9/30 (30%), Positives = 18/30 (60%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKR 34 ++R+RGR+R+R+ K + R + + R Sbjct: 1308 RDRERGRERDRRDTKRHSRSRSRSTPVRDR 1337 >gi|151301171 RNA polymerase II transcription factor TAFII140 [Homo sapiens] Length = 929 Score = 41.2 bits (95), Expect = 2e-04 Identities = 18/33 (54%), Positives = 26/33 (78%) Query: 8 KRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 K K++ KKEK++KKE+EK KEK+R+KEK + Sbjct: 697 KEKEKKKDKKEKKKKKEKEKEKKEKEREKEKRE 729 Score = 40.8 bits (94), Expect = 2e-04 Identities = 18/31 (58%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Query: 12 KRERKKEKERKKEREKGNKEK-KRKKEKEKD 41 ++E++K K++KK+REKG K+K KR+KEK KD Sbjct: 610 RKEKEKHKDKKKDREKGKKDKDKREKEKVKD 640 Score = 40.4 bits (93), Expect = 3e-04 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Query: 5 KERKRGRKRERKKEKERK-KEREKGNKEK-KRKKEKEK 40 K+ K+ +K++++KEKE+K KEREK +E+ KR+KEKEK Sbjct: 702 KKDKKEKKKKKEKEKEKKEKEREKEKREREKREKEKEK 739 Score = 39.3 bits (90), Expect = 7e-04 Identities = 17/29 (58%), Positives = 24/29 (82%) Query: 16 KKEKERKKEREKGNKEKKRKKEKEKDHLE 44 +KEK ++KE++K KEKK+KKEKEK+ E Sbjct: 692 EKEKVKEKEKKKDKKEKKKKKEKEKEKKE 720 Score = 38.5 bits (88), Expect = 0.001 Identities = 15/45 (33%), Positives = 32/45 (71%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTP 49 K+ K+ +K + K++KE+++E+EK +EK+ K++++ H + V P Sbjct: 705 KKEKKKKKEKEKEKKEKEREKEKREREKREKEKEKHKHEKIKVEP 749 Score = 38.1 bits (87), Expect = 0.002 Identities = 16/41 (39%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Query: 5 KERKRGRKRERKKEK-ERKKEREKGNKEKKRKKEKEKDHLE 44 +E+++ +++E+KK+K E+KK++EK ++K++++EKEK E Sbjct: 691 EEKEKVKEKEKKKDKKEKKKKKEKEKEKKEKEREKEKRERE 731 Score = 37.4 bits (85), Expect = 0.003 Identities = 20/42 (47%), Positives = 28/42 (66%), Gaps = 5/42 (11%) Query: 5 KERKRGRKRERKKEKERKKEREKG-----NKEKKRKKEKEKD 41 K +K + + +KKEK+R +EREK +KEK + KEKEKD Sbjct: 524 KLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVKEKEKD 565 Score = 35.8 bits (81), Expect = 0.008 Identities = 14/41 (34%), Positives = 27/41 (65%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEW 45 KE++R R+RE+ K K++ KE++K +++K K+ + W Sbjct: 536 KEKQRDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPW 576 Score = 34.3 bits (77), Expect = 0.022 Identities = 15/35 (42%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKE 39 K++++ R RER+K+K + K +EK +K K+++K+KE Sbjct: 534 KKKEKQRDREREKDKNKDKSKEK-DKVKEKEKDKE 567 Score = 31.2 bits (69), Expect = 0.19 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 4/42 (9%) Query: 6 ERKRGRKRERK---KEKERKKEREKGNKEKKRKKEKEKDHLE 44 E K+ K+E K K+KE++++RE+ K+K + K KEKD ++ Sbjct: 520 EVKKKLKKELKTKMKKKEKQRDRER-EKDKNKDKSKEKDKVK 560 Score = 31.2 bits (69), Expect = 0.19 Identities = 12/40 (30%), Positives = 26/40 (65%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLE 44 +ER++ + +++ KEK++ KE+EK + + K K+ L+ Sbjct: 542 REREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLK 581 Score = 31.2 bits (69), Expect = 0.19 Identities = 15/45 (33%), Positives = 28/45 (62%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKDHLEWVVTP 49 KE+ + +K++R+K K+ K +REK + K +++K K +V P Sbjct: 613 KEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLP 657 Score = 29.3 bits (64), Expect = 0.71 Identities = 12/39 (30%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Query: 2 EGGKERKRGRKRERKKEKER-KKEREKGNKEKKRKKEKE 39 +G +++ + +++KK++E+ KK+++K KEK + K +E Sbjct: 606 DGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGRE 644 Score = 28.1 bits (61), Expect = 1.6 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 2 EGGKERKRGRKRERKKEKE-RKKEREKGNKEK 32 E KE+K + + K+E+E R+KE+EK EK Sbjct: 713 EKEKEKKEKEREKEKREREKREKEKEKHKHEK 744 Score = 26.9 bits (58), Expect = 3.5 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Query: 2 EGGKERKRGRKRERKKEKERKKE--REKGNKEKKRKKEKEKD 41 E K + + +++++ KEKE+ KE RE K+ KE+E D Sbjct: 545 EKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEAD 586 >gi|4757926 RNA binding motif protein 39 isoform b [Homo sapiens] Length = 524 Score = 41.2 bits (95), Expect = 2e-04 Identities = 18/37 (48%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEKD 41 KERKR R RERKK K R+++R + +KE++R + + +D Sbjct: 53 KERKRSRDRERKKSKSRERKRSR-SKERRRSRSRSRD 88 Score = 36.6 bits (83), Expect = 0.004 Identities = 14/35 (40%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Query: 6 ERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 ERKR + +ERK+ ++R++++ K ++E+KR + KE+ Sbjct: 46 ERKRSKSKERKRSRDRERKKSK-SRERKRSRSKER 79 Score = 32.0 bits (71), Expect = 0.11 Identities = 12/38 (31%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Query: 3 GGKERKRGRKRERKKEKERKKEREKGNKEKKRKKEKEK 40 G +ER + RK+ + + + +++R K +KE+KR +++E+ Sbjct: 27 GHEERSKKRKKSKSRSRSHERKRSK-SKERKRSRDRER 63 Score = 29.3 bits (64), Expect = 0.71 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Query: 5 KERKRGRKRERKKEKERKKEREKGNK---EKKRKKEKEKD 41 + +KR + + R + ERK+ + K K +++RKK K ++ Sbjct: 31 RSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRE 70 Score = 28.9 bits (63), Expect = 0.93 Identities = 9/30 (30%), Positives = 19/30 (63%) Query: 5 KERKRGRKRERKKEKERKKEREKGNKEKKR 34 +ERK+ + RERK+ + +++ R + +R Sbjct: 61 RERKKSKSRERKRSRSKERRRSRSRSRDRR 90 Score = 27.7 bits (60), Expect = 2.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 2 EGGKERKRGRKRERKKEKERKKEREKGNKEKKR 34 E K + R RKR R KE+ R + R + + + R Sbjct: 62 ERKKSKSRERKRSRSKERRRSRSRSRDRRFRGR 94 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.307 0.127 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,917,002 Number of Sequences: 37866 Number of extensions: 147683 Number of successful extensions: 15620 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 139 Number of HSP's that attempted gapping in prelim test: 3902 Number of HSP's gapped (non-prelim): 8040 length of query: 60 length of database: 18,247,518 effective HSP length: 33 effective length of query: 27 effective length of database: 16,997,940 effective search space: 458944380 effective search space used: 458944380 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.