BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|10835057 alpha-N-acetyltransferase 1A [Homo sapiens] (235 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|10835057 alpha-N-acetyltransferase 1A [Homo sapiens] 474 e-134 gi|14249280 alpha-N-acetyltransferase 1B [Homo sapiens] 373 e-104 gi|31563512 N-acetyltransferase 5 isoform b [Homo sapiens] 83 2e-16 gi|7705823 N-acetyltransferase 5 isoform a [Homo sapiens] 82 4e-16 gi|31563514 N-acetyltransferase 5 isoform c [Homo sapiens] 64 9e-11 gi|190341107 N-acetyltransferase 12 [Homo sapiens] 59 3e-09 gi|13376735 N-acetyltransferase 13 [Homo sapiens] 44 1e-04 gi|4557509 cylicin 2 [Homo sapiens] 38 0.009 gi|89001107 dentin sialophosphoprotein preproprotein [Homo sapiens] 36 0.025 gi|134254455 N-acetyltransferase 15 [Homo sapiens] 34 0.095 gi|134254440 N-acetyltransferase 15 [Homo sapiens] 34 0.095 gi|13376261 N-acetyltransferase 15 [Homo sapiens] 34 0.095 gi|55749769 CWC22 spliceosome-associated protein homolog [Homo s... 34 0.095 gi|117190254 heterogeneous nuclear ribonucleoprotein C isoform b... 33 0.21 gi|117190192 heterogeneous nuclear ribonucleoprotein C isoform a... 33 0.21 gi|117190174 heterogeneous nuclear ribonucleoprotein C isoform b... 33 0.21 gi|117189975 heterogeneous nuclear ribonucleoprotein C isoform a... 33 0.21 gi|21735415 centromere protein B [Homo sapiens] 33 0.28 gi|156104891 general transcription factor IIF, polypeptide 1, 74... 33 0.28 gi|211971067 heterogeneous nuclear ribonucleoprotein C-like [Hom... 33 0.28 gi|148368962 NKF3 kinase family member [Homo sapiens] 33 0.28 gi|5453567 craniofacial development protein 1 [Homo sapiens] 32 0.36 gi|5032281 dystrophin Dp427c isoform [Homo sapiens] 32 0.47 gi|5032315 dystrophin Dp427p2 isoform [Homo sapiens] 32 0.47 gi|5032287 dystrophin Dp427p1 isoform [Homo sapiens] 32 0.47 gi|5032285 dystrophin Dp427l isoform [Homo sapiens] 32 0.47 gi|5032283 dystrophin Dp427m isoform [Homo sapiens] 32 0.47 gi|4759128 solute carrier family 24 (sodium/potassium/calcium ex... 32 0.62 gi|30581135 structural maintenance of chromosomes 1A [Homo sapiens] 31 0.81 gi|14195601 protein phosphatase 1, regulatory (inhibitor) subuni... 31 0.81 >gi|10835057 alpha-N-acetyltransferase 1A [Homo sapiens] Length = 235 Score = 474 bits (1219), Expect = e-134 Identities = 235/235 (100%), Positives = 235/235 (100%) Query: 1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM 60 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM Sbjct: 1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM 60 Query: 61 EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH 120 EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH Sbjct: 61 EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH 120 Query: 121 LYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKV 180 LYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKV Sbjct: 121 LYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKV 180 Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS Sbjct: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 >gi|14249280 alpha-N-acetyltransferase 1B [Homo sapiens] Length = 229 Score = 373 bits (957), Expect = e-104 Identities = 191/235 (81%), Positives = 212/235 (90%), Gaps = 6/235 (2%) Query: 1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM 60 MNIRNA+P+DLMNMQHCNLLCLPENYQMKYY YHGLSWPQLSYIAEDE+GKIVGYVLAKM Sbjct: 1 MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKM 60 Query: 61 EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH 120 EE+PDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNR ALH Sbjct: 61 EEEPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALH 120 Query: 121 LYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKV 180 LYSNTLNFQISEVEPKYYADGEDAYAMKRDL+QMADELRR ++LK KG +VVLG+ EN+ Sbjct: 121 LYSNTLNFQISEVEPKYYADGEDAYAMKRDLSQMADELRRQMDLK-KGGYVVLGSRENQ- 178 Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 E++G++ S EAC ++K A E+SG DSK E E+ EST+V+DSSE+SDS S Sbjct: 179 ETQGSTLSDSEEAC-QQKNPATEESGSDSK---EPKESVESTNVQDSSESSDSTS 229 >gi|31563512 N-acetyltransferase 5 isoform b [Homo sapiens] Length = 166 Score = 82.8 bits (203), Expect = 2e-16 Identities = 51/148 (34%), Positives = 80/148 (54%), Gaps = 8/148 (5%) Query: 12 MNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEED-PDDVPHG 70 M Q CNL L E Y + +Y + WP+ +AE G+++GY++ K E + HG Sbjct: 1 MLSQSCNLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHG 60 Query: 71 HITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQI 130 H+T+L+V RRLGLA KLM+ + E +V L VR SN+ A+++Y L + + Sbjct: 61 HVTALSVAPEFRRLGLAAKLMELLEE-ISERKGGFFVDLFVRVSNQVAVNMYKQ-LGYSV 118 Query: 131 SEVEPKYYA-----DGEDAYAMKRDLTQ 153 +YY+ EDAY M++ L++ Sbjct: 119 YRTVIEYYSASNGEPDEDAYDMRKALSR 146 >gi|7705823 N-acetyltransferase 5 isoform a [Homo sapiens] Length = 178 Score = 82.0 bits (201), Expect = 4e-16 Identities = 50/151 (33%), Positives = 81/151 (53%), Gaps = 8/151 (5%) Query: 9 EDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEED-PDDV 67 +DL + NL L E Y + +Y + WP+ +AE G+++GY++ K E + Sbjct: 10 DDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREE 69 Query: 68 PHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLN 127 HGH+T+L+V RRLGLA KLM+ + E +V L VR SN+ A+++Y L Sbjct: 70 WHGHVTALSVAPEFRRLGLAAKLMELLEE-ISERKGGFFVDLFVRVSNQVAVNMYKQ-LG 127 Query: 128 FQISEVEPKYYA-----DGEDAYAMKRDLTQ 153 + + +YY+ EDAY M++ L++ Sbjct: 128 YSVYRTVIEYYSASNGEPDEDAYDMRKALSR 158 >gi|31563514 N-acetyltransferase 5 isoform c [Homo sapiens] Length = 111 Score = 64.3 bits (155), Expect = 9e-11 Identities = 34/99 (34%), Positives = 55/99 (55%), Gaps = 6/99 (6%) Query: 9 EDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEED-PDDV 67 +DL + NL L E Y + +Y + WP+ +AE G+++GY++ K E + Sbjct: 10 DDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREE 69 Query: 68 PHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKY 106 HGH+T+L+V RRLGLA KLM+ ++E + +Y Sbjct: 70 WHGHVTALSVAPEFRRLGLAAKLME-----LLEEISERY 103 >gi|190341107 N-acetyltransferase 12 [Homo sapiens] Length = 362 Score = 59.3 bits (142), Expect = 3e-09 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 3/127 (2%) Query: 22 LPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSH 81 L E Y + Y Y +WPQL ++A + VG ++ K++ G+I LAV + Sbjct: 235 LSEPYSIYTYRYFIHNWPQLCFLAM-VGEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKY 293 Query: 82 RRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADG 141 RR G+ L+ +A AM+E + V L +N++AL LY N L F + +YY +G Sbjct: 294 RRNGIGTNLVKKAIYAMVEG-DCDEVVLETEITNKSALKLYEN-LGFVRDKRLFRYYLNG 351 Query: 142 EDAYAMK 148 DA +K Sbjct: 352 VDALRLK 358 >gi|13376735 N-acetyltransferase 13 [Homo sapiens] Length = 169 Score = 43.9 bits (102), Expect = 1e-04 Identities = 35/153 (22%), Positives = 73/153 (47%), Gaps = 6/153 (3%) Query: 1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM 60 + + + P ++ ++ N + P +Y K+Y L +L+ +A N VG V ++ Sbjct: 6 IELGDVTPHNIKQLKRLNQVIFPVSYNDKFY-KDVLEVGELAKLAYF-NDIAVGAVCCRV 63 Query: 61 EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH 120 + + +I +L +RRLG+ K+++ ++ + LHV+ SN +A+ Sbjct: 64 DHSQNQ-KRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAID 122 Query: 121 LYSNTLNFQISEVEPKYY--ADGEDAYAMKRDL 151 Y F+I E + YY + DA+ ++++L Sbjct: 123 FY-RKFGFEIIETKKNYYKRIEPADAHVLQKNL 154 >gi|4557509 cylicin 2 [Homo sapiens] Length = 348 Score = 37.7 bits (86), Expect = 0.009 Identities = 30/95 (31%), Positives = 49/95 (51%), Gaps = 8/95 (8%) Query: 141 GEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGL 200 GED K D T EL++ + +KG+ + G E K+++K +S +A EKG Sbjct: 118 GEDKTTQK-DTTDSESELKQGKKDSKKGKDIEKGK-EEKLDAKKDSKKGKKDA---EKG- 171 Query: 201 AAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +DS +S+D ++ D KDS++ DSA+ Sbjct: 172 --KDSATESEDEKGGAKKDNKKDKKDSNKGKDSAT 204 >gi|89001107 dentin sialophosphoprotein preproprotein [Homo sapiens] Length = 1301 Score = 36.2 bits (82), Expect = 0.025 Identities = 17/51 (33%), Positives = 31/51 (60%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 NS SS + +++ + DS D S S++++S+D DSS++SDS++ Sbjct: 952 NSSDSSNSSDSSNSSDSSDSNSSDSSDSSNSSDSSDSSDSSDSSDSSDSSN 1002 Score = 35.4 bits (80), Expect = 0.043 Identities = 17/55 (30%), Positives = 31/55 (56%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S E + + DS D S+ S++++S+D DSS++SDS++ Sbjct: 1068 DSSDSSDSSDSSDSSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSN 1122 Score = 35.0 bits (79), Expect = 0.056 Identities = 17/57 (29%), Positives = 30/57 (52%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S+ + + DS D S+ S +++S+D DSS++SDS+ Sbjct: 1017 NSSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSS 1073 Score = 34.7 bits (78), Expect = 0.073 Identities = 17/59 (28%), Positives = 32/59 (54%) Query: 177 ENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 ++K +S + SS + + + D+ D S+ S ++ S+D DSS++SDS+S Sbjct: 621 DSKSDSSKSESDSSDSDSKSDSSDSNSSDSSDNSDSSDSSNSSNSSDSSDSSDSSDSSS 679 Score = 34.7 bits (78), Expect = 0.073 Identities = 17/54 (31%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D DSSE+SDS+ Sbjct: 1035 DSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSS 1088 Score = 34.7 bits (78), Expect = 0.073 Identities = 17/54 (31%), Positives = 30/54 (55%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + + DS D SE S++++S+D DSS++SDS+ Sbjct: 1116 DSSDSSNSSDSSDSSDSSDSSDSSNSSDSSDSSESSDSSDSSDSSDSSDSSDSS 1169 Score = 34.7 bits (78), Expect = 0.073 Identities = 17/58 (29%), Positives = 30/58 (51%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 N +S +S S + DS D S+ S++++S+D DSS++SDS++ Sbjct: 1122 NSSDSSDSSDSSDSSDSSNSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSN 1179 Score = 34.7 bits (78), Expect = 0.073 Identities = 17/55 (30%), Positives = 29/55 (52%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S + + DS D S+ S++ ES+D DSS++SDS++ Sbjct: 1194 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDSSN 1248 Score = 34.3 bits (77), Expect = 0.095 Identities = 15/55 (27%), Positives = 33/55 (60%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S ++ S ++ + +++ DS + S+ S++++S+D DSS++SDS S Sbjct: 570 DSSDSNSSSDSDSSDSDSSDSSDSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSKS 624 Score = 34.3 bits (77), Expect = 0.095 Identities = 17/57 (29%), Positives = 29/57 (50%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S + + DS D S S++++S+D DSS++SDS+ Sbjct: 1056 NSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSSDSSNSSDSSDSSDSSDSSDSSDSS 1112 Score = 34.3 bits (77), Expect = 0.095 Identities = 17/54 (31%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 ES +S S+ + + DS D S+ S+++ S+D DSS++SDS+ Sbjct: 1083 ESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSS 1136 Score = 34.3 bits (77), Expect = 0.095 Identities = 17/57 (29%), Positives = 29/57 (50%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S + + DS D S+ S +++S+D DSS++SDS+ Sbjct: 1140 NSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSS 1196 Score = 34.3 bits (77), Expect = 0.095 Identities = 17/55 (30%), Positives = 29/55 (52%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S + + + DS D S+ S+++ S+D DSS++SDS S Sbjct: 1209 DSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDSSNSSDSSDSSDSSDSTS 1263 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/55 (29%), Positives = 30/55 (54%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S + + + DS D S+ S +++S+D DSS++SDS++ Sbjct: 727 DSSNSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSN 781 Score = 33.9 bits (76), Expect = 0.12 Identities = 17/57 (29%), Positives = 29/57 (50%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S+ + + DS D S+ S+++ S+D DSS +SDS+ Sbjct: 739 NSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSS 795 Score = 33.9 bits (76), Expect = 0.12 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSG--GDSKDLSEVSETTESTDVKDSSEASDSAS 235 N +S +S S + + DS DS D S+ S+++ S+D DSS++SDS++ Sbjct: 958 NSSDSSNSSDSSDSNSSDSSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSN 1017 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/57 (28%), Positives = 31/57 (54%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S + + + DS D S+ S++++S+D DSS++S+S+ Sbjct: 1002 NSSDSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSS 1058 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/57 (28%), Positives = 31/57 (54%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S + + + DS D S+ S++++S+D DSS++S+S+ Sbjct: 1029 NSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSESS 1085 Score = 33.9 bits (76), Expect = 0.12 Identities = 17/54 (31%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S+++ES+D DSS +SDS+ Sbjct: 1044 DSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSSDSSNSSDSS 1097 Score = 33.9 bits (76), Expect = 0.12 Identities = 17/54 (31%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S+++ S+D DSSE+SDS+ Sbjct: 1101 DSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSSDSSESSDSS 1154 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/54 (29%), Positives = 30/54 (55%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + + DS D S+ S++++S+D DSS++SDS+ Sbjct: 1155 DSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 1208 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D DSS++SDS+ Sbjct: 1161 DSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 1214 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/54 (29%), Positives = 30/54 (55%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S+ + + DS D S+ S++++S+D DSS++SDS+ Sbjct: 1170 DSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 1223 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D DSS++SDS+ Sbjct: 1176 DSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 1229 Score = 33.5 bits (75), Expect = 0.16 Identities = 17/57 (29%), Positives = 31/57 (54%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N ES +S S ++ + S DS + S+ S+++ S+D DSS++S+S+ Sbjct: 697 NSSESSDSSDSSDSDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDSSNSS 753 Score = 33.5 bits (75), Expect = 0.16 Identities = 16/57 (28%), Positives = 30/57 (52%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S + + DS + S+ S++++S+D DSS++SDS+ Sbjct: 1023 NSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSS 1079 Score = 33.5 bits (75), Expect = 0.16 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D DSS++SDS+ Sbjct: 1158 DSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 1211 Score = 33.5 bits (75), Expect = 0.16 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D DSS++SDS+ Sbjct: 1167 DSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 1220 Score = 33.5 bits (75), Expect = 0.16 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D DS+E+SDS+ Sbjct: 1185 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSS 1238 Score = 33.1 bits (74), Expect = 0.21 Identities = 16/50 (32%), Positives = 31/50 (62%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S SS + + +++ S +S D S+ S +++S+D DSS++SDS+ Sbjct: 949 DSSNSSDSSNSSDSSNSSDSSDSNSSDSSDSSNSSDSSDSSDSSDSSDSS 998 Score = 33.1 bits (74), Expect = 0.21 Identities = 16/54 (29%), Positives = 30/54 (55%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S+ + + DS D S+ SE+++S+D +SS++SDS+ Sbjct: 1047 DSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSSDSSNSSDSSDSS 1100 Score = 33.1 bits (74), Expect = 0.21 Identities = 16/54 (29%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D DSS +SDS+ Sbjct: 1074 DSSDSSDSSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSS 1127 Score = 33.1 bits (74), Expect = 0.21 Identities = 16/54 (29%), Positives = 30/54 (55%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S+ + + +S D S+ SE+++S+D DSS++SDS+ Sbjct: 1113 DSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSSDSSESSDSSDSSDSSDSSDSS 1166 Score = 32.7 bits (73), Expect = 0.28 Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S ++ +++ +S D S+ S +++S+D DSS +SDS+ Sbjct: 703 DSSDSSDSDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDSSNSSDSS 756 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/53 (30%), Positives = 31/53 (58%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 + +S SS + + +++ S DS + S+ S +++S+D DSS +SDS+ Sbjct: 828 NSSDSSDSSNSSDSSDSSDSSDGSDSDSSNRSDSSNSSDSSDSSDSSNSSDSS 880 Score = 32.7 bits (73), Expect = 0.28 Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + + DS + S+ S++++S+D DSS++SDS+ Sbjct: 999 DSSNSSDSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSSDSS 1052 Score = 32.7 bits (73), Expect = 0.28 Identities = 15/55 (27%), Positives = 30/55 (54%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S + + DS D S+ S++++S+D +SS++SDS++ Sbjct: 1038 DSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSSDSSN 1092 Score = 32.7 bits (73), Expect = 0.28 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 NS SS + + +++ S DS D S+ S +++S+D DSS++SDS++ Sbjct: 1092 NSSDSSDSSDSSDSSDSSDSS--DSSDSSDSSNSSDSSDSSDSSDSSDSSN 1140 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS + S+ S+++ES+D DSS++SDS+ Sbjct: 1110 DSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSSDSSESSDSSDSSDSSDSS 1163 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S+ + + DS D S+ S++++S+D DSS +SDS+ Sbjct: 1131 DSSDSSDSSNSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSS 1184 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 ES +S S + + DS + S+ S++++S+D DSS++SDS+ Sbjct: 1149 ESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSS 1202 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/54 (29%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + DS D S+ S++++S+D DSS++SDS+ Sbjct: 1164 DSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSS 1217 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/54 (29%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D +E S++++S+D DSS +SDS+ Sbjct: 1200 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDSSNSSDSS 1253 Score = 32.3 bits (72), Expect = 0.36 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 N +S +S S + + + DS + SE S++++S+D DSS++SDS++ Sbjct: 664 NSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSDSSD-SDSSDSSDSSN 720 Score = 32.3 bits (72), Expect = 0.36 Identities = 16/53 (30%), Positives = 27/53 (50%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 S NS S + + DS D S S++++S+D +SS++SDS+ Sbjct: 719 SNSNSSDSDSSNSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSS 771 Score = 32.3 bits (72), Expect = 0.36 Identities = 18/58 (31%), Positives = 27/58 (46%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 N +S +S S + DS D S S+++ S+D DSS++SDS S Sbjct: 763 NSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSDSSDSSDSSDSDS 820 Score = 32.3 bits (72), Expect = 0.36 Identities = 15/50 (30%), Positives = 30/50 (60%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 NS SS + + +++ +S D S S++++S++ DSS++SDS+ Sbjct: 799 NSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSSDSSDSS 848 Score = 32.3 bits (72), Expect = 0.36 Identities = 17/51 (33%), Positives = 27/51 (52%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 NS SS + + + +S D S+ S +++S+D DSS+ SDS S Sbjct: 805 NSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSSDSSDSSDGSDSDS 855 Score = 32.3 bits (72), Expect = 0.36 Identities = 16/51 (31%), Positives = 29/51 (56%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 NS SS + + + + DS D S S+++ES++ D+S +SDS++ Sbjct: 890 NSSDSSDSSNSSDSDSSDSSNSSDSSDSSNSSDSSESSNSSDNSNSSDSSN 940 Score = 32.3 bits (72), Expect = 0.36 Identities = 16/54 (29%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S+ + DS D S+ S++++S+D DSS +SDS+ Sbjct: 1008 DSSDSSDSSNSSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSS 1061 Score = 32.3 bits (72), Expect = 0.36 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS + S+ S++++S+D DSS++SDS+ Sbjct: 1119 DSSNSSDSSDSSDSSDSSDSSNSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSS 1172 Score = 32.3 bits (72), Expect = 0.36 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S E + DS D S+ S++++S+D +SS++SDS+ Sbjct: 1134 DSSDSSNSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSS 1187 Score = 32.3 bits (72), Expect = 0.36 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S++ DSS++SDS+ Sbjct: 1137 DSSNSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSS 1190 Score = 32.3 bits (72), Expect = 0.36 Identities = 16/54 (29%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S S++++S+D DSS++SDS+ Sbjct: 1146 DSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSS 1199 Score = 32.3 bits (72), Expect = 0.36 Identities = 15/57 (26%), Positives = 30/57 (52%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S + + DS D S+ S++++S+D DSS++++S+ Sbjct: 1179 NSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESS 1235 Score = 32.0 bits (71), Expect = 0.47 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Query: 182 SKGNSPPSSGEACREEKGLAAEDS-GGDSKDLSEVSETTESTDVKDSSEASDSAS 235 S NS SS + + ++ S DS D S+ S +++S++ DSS++SDS++ Sbjct: 643 SDSNSSDSSDNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSN 697 Score = 32.0 bits (71), Expect = 0.47 Identities = 16/56 (28%), Positives = 28/56 (50%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDS 233 N +S +S S + + DS + S+ S++++S+D DSS +SDS Sbjct: 730 NSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDS 785 Score = 32.0 bits (71), Expect = 0.47 Identities = 16/57 (28%), Positives = 28/57 (49%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S + + DS D S S+++ S+D +SS++SDS+ Sbjct: 981 NSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSS 1037 Score = 32.0 bits (71), Expect = 0.47 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS + S+ S++++S+D DSS++SDS+ Sbjct: 1062 DSSDSSDSSDSSDSSDSSDSSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSS 1115 Score = 32.0 bits (71), Expect = 0.47 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D DSS++S+S+ Sbjct: 1071 DSSDSSDSSDSSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSS 1124 Score = 32.0 bits (71), Expect = 0.47 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D DSS++S+S+ Sbjct: 1128 DSSDSSDSSDSSNSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSS 1181 Score = 32.0 bits (71), Expect = 0.47 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D +SS++SDS+ Sbjct: 1188 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSS 1241 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +SK +S S+ + + + +S D S+ S++++S+ DSS +SDS+ Sbjct: 637 DSKSDSSDSNSSDSSDNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSS 690 Score = 31.6 bits (70), Expect = 0.62 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGG-DSKDLSEVSETTESTDVKDSSEASDSAS 235 + NS SS + + +++ S DS D S+ S ++ES+D DSS++ S S Sbjct: 661 NSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSDSSDSDSSDS 715 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S+ + + + DS + S+ S +++S+D DSS++SDS+ Sbjct: 993 DSSDSSDSSNSSDSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSSDSSDSSDSS 1046 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S+D +SS++SDS+ Sbjct: 1011 DSSDSSNSSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSS 1064 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S+ + DS D S+ S++++S++ DSS++SDS+ Sbjct: 1014 DSSNSSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSS 1067 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS + S+ S+++ S+D DSS++SDS+ Sbjct: 1053 DSSNSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSSDSSNSSDSSDSSDSSDSS 1106 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S +++S+D +SS++SDS+ Sbjct: 1104 DSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSSDSSESSDSSDSS 1157 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + +S D S+ S++++S+D DSS++SDS+ Sbjct: 1152 DSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSS 1205 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S + DSS++SDS+ Sbjct: 1191 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSS 1244 Score = 31.6 bits (70), Expect = 0.62 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ +E+++S+D DSS++S+S+ Sbjct: 1197 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDSSNSS 1250 Score = 31.2 bits (69), Expect = 0.81 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S+ +S S ++ + + DS D S S +++S+D DSS++S S+ Sbjct: 628 KSESDSSDSDSKSDSSDSNSSDSSDNSDSSDSSNSSNSSDSSDSSDSSDSSSSS 681 Score = 31.2 bits (69), Expect = 0.81 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S G + + + DS D S+ S +++S+D DS+E+S+S+ Sbjct: 837 NSSDSSDSSDSSDGSDS-DSSNRSDSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSS 892 Score = 31.2 bits (69), Expect = 0.81 Identities = 16/50 (32%), Positives = 28/50 (56%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 NS SS + E +++ S + S+ S+++ S+D DSS +SDS+ Sbjct: 875 NSSDSSDSSDSNESSNSSDSSDSSNSSDSDSSDSSNSSDSSDSSNSSDSS 924 Score = 31.2 bits (69), Expect = 0.81 Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + + DS D S+ S +++S++ DSS +SDS+ Sbjct: 916 DSSNSSDSSESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDSSNSSDSSNSSDSS 969 Score = 31.2 bits (69), Expect = 0.81 Identities = 17/55 (30%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Query: 185 NSPPSSGEACREEKGLAAEDSGG----DSKDLSEVSETTESTDVKDSSEASDSAS 235 NS SS + + +++ S +S D S+ S++++S+D DSS++SDS++ Sbjct: 1002 NSSDSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSN 1056 Score = 31.2 bits (69), Expect = 0.81 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + +S D S+ S++++S+D DSS++SDS+ Sbjct: 1065 DSSDSSDSSDSSDSSDSSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSS 1118 Score = 31.2 bits (69), Expect = 0.81 Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S+ S++++S++ DSS++SDS+ Sbjct: 1080 DSSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSS 1133 Score = 31.2 bits (69), Expect = 0.81 Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS D S S++++S+D DSS++S+S+ Sbjct: 1089 DSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSS 1142 Score = 31.2 bits (69), Expect = 0.81 Identities = 15/57 (26%), Positives = 30/57 (52%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S + + +S D S+ S++++S+D +SS++SDS+ Sbjct: 1092 NSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSSDSS 1148 Score = 30.8 bits (68), Expect = 1.1 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDL--SEVSETTESTDVKDSSEASDSA 234 N +S +S S ++ +++ DS D S+ S +++S+D DSS++SDS+ Sbjct: 559 NSSDSSDSSDSDSSDSNSSSDSDSSDSDSSDSSDSDSSDSSNSSDSSDSSDSSDSSDSS 617 Score = 30.8 bits (68), Expect = 1.1 Identities = 16/57 (28%), Positives = 26/57 (45%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N +S NS S + DS S+ S +++S+D DSS +S+S+ Sbjct: 646 NSSDSSDNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESS 702 Score = 30.8 bits (68), Expect = 1.1 Identities = 15/55 (27%), Positives = 29/55 (52%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S + ++ +S D S+ S+++ S++ DSS++SDS S Sbjct: 658 DSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSESSDSSDSSDSDS 712 Score = 30.8 bits (68), Expect = 1.1 Identities = 14/54 (25%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S + S ++ + + DS D S S++++S+D +SS++SDS+ Sbjct: 706 DSSDSDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDSSNSSDSSDSS 759 Score = 30.8 bits (68), Expect = 1.1 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGG-DSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S +S ++ +++ S DS D S+ S +++S+D DSS +SDS+ Sbjct: 714 DSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSS 768 Score = 30.8 bits (68), Expect = 1.1 Identities = 16/57 (28%), Positives = 28/57 (49%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 N + +S SS + +++ S D S S+++ S+D DSS +SDS+ Sbjct: 786 NDSSNSSDSSDSSNSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSS 842 Score = 30.8 bits (68), Expect = 1.1 Identities = 15/50 (30%), Positives = 31/50 (62%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S SS + + +++ S DS + S+ S +++S+D +SS++SDS+ Sbjct: 796 DSSNSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSSDSS 845 Score = 30.8 bits (68), Expect = 1.1 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Query: 182 SKGNSPPSSGEACREEKGLAAEDS----GGDSKDLSEVSETTESTDVKDSSEASDSAS 235 S G+ SS + +++ S DS D S+ +E++ S+D DSS +SDS S Sbjct: 848 SDGSDSDSSNRSDSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSSDSSNSSDSDS 905 Score = 30.8 bits (68), Expect = 1.1 Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 S +S S+ E + + DS + S+ S++++S++ DSS +SDS++ Sbjct: 911 SSDSSDSSNSSDSSESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDSSNSSDSSN 964 Score = 30.8 bits (68), Expect = 1.1 Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + DS D S+ S++++S+D +SS++SDS+ Sbjct: 1077 DSSDSSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSS 1130 Score = 30.4 bits (67), Expect = 1.4 Identities = 15/53 (28%), Positives = 28/53 (52%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 S +S S+ + + DS D S S++++S+D DSS++S+S+ Sbjct: 731 SSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSS 783 Score = 30.4 bits (67), Expect = 1.4 Identities = 15/58 (25%), Positives = 30/58 (51%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 N +S +S S + + +S D S+ S++++S++ DSS +SDS++ Sbjct: 972 NSSDSSDSSNSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSNSSDSSNSSDSSN 1029 Score = 30.4 bits (67), Expect = 1.4 Identities = 15/54 (27%), Positives = 27/54 (50%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + DS D S S++++S++ DSS++SDS+ Sbjct: 1107 DSSDSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSSDSSESSDSSDSSDSS 1160 Score = 30.0 bits (66), Expect = 1.8 Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + + DS D S S++++S++ DSS +SDS+ Sbjct: 757 DSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSDSS 810 Score = 30.0 bits (66), Expect = 1.8 Identities = 15/54 (27%), Positives = 27/54 (50%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + +S D S S+++ S+D DSS++SDS+ Sbjct: 990 DSSDSSDSSDSSNSSDSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSSDSSDSS 1043 Score = 30.0 bits (66), Expect = 1.8 Identities = 14/54 (25%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS + S+ S++++S+D +SS++SDS+ Sbjct: 1203 DSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDSSNSSDSSDSS 1256 Score = 30.0 bits (66), Expect = 1.8 Identities = 14/54 (25%), Positives = 29/54 (53%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + +S D S+ S++++S++ DSS++SDS+ Sbjct: 1206 DSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDSSNSSDSSDSSDSS 1259 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S S ++ + E + DS DS D S +++S+D DSS++S+S++ Sbjct: 618 DSSDSKSDSSKSESDSSDSDSKSDSSD----SNSSDSSDNSDSSDSSNSSN 664 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/55 (27%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S+ + + +++ S DS + S+ S++++S++ DSS++SDS++ Sbjct: 711 DSSDSSDSSNSNSSDSDSSNSSDSS--DSSNSSDSSDSSDSSNSSDSSDSSDSSN 763 Score = 29.3 bits (64), Expect = 3.1 Identities = 14/54 (25%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS + S+ S+++ S+D +SS++SDS+ Sbjct: 760 DSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSDSSDSS 813 Score = 29.3 bits (64), Expect = 3.1 Identities = 13/51 (25%), Positives = 30/51 (58%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S SS + + +++ DS + S+ S+++ S+D +SS +SD+++ Sbjct: 884 DSNESSNSSDSSDSSNSSDSDSSDSSNSSDSSDSSNSSDSSESSNSSDNSN 934 Score = 29.3 bits (64), Expect = 3.1 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGG--DSKDLSEVSETTESTDVKDSSEASDSA 234 N +S +S S ++ + DS DS + S S+ + S+D +SS++SDS+ Sbjct: 890 NSSDSSDSSNSSDSDSSDSSNSSDSSDSSNSSDSSESSNSSDNSNSSDSSNSSDSSDSS 948 Score = 29.3 bits (64), Expect = 3.1 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Query: 185 NSPPSSGEACREEKGLAAEDSGG----DSKDLSEVSETTESTDVKDSSEASDSAS 235 NS SS + + +++ S DS D S S+++ S+D +SS++SDS S Sbjct: 919 NSSDSSESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSNS 973 Score = 28.9 bits (63), Expect = 4.0 Identities = 13/55 (23%), Positives = 29/55 (52%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S ++ + + +S D S+ S++++S+D DSS++ +S Sbjct: 573 DSNSSSDSDSSDSDSSDSSDSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSS 627 Score = 28.9 bits (63), Expect = 4.0 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 7/60 (11%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVS-------ETTESTDVKDSSEASDSA 234 + +S SS + E +++ S DS D S+ S +++ S+D DSS +SDS+ Sbjct: 685 NSSDSSDSSDSSNSSESSDSSDSSDSDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSS 744 Score = 28.9 bits (63), Expect = 4.0 Identities = 13/53 (24%), Positives = 29/53 (54%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 + +S S+ + + DS + S+ S++++S++ DSS++SDS+ Sbjct: 722 NSSDSDSSNSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSS 774 Score = 28.9 bits (63), Expect = 4.0 Identities = 14/53 (26%), Positives = 29/53 (54%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 + +S SS + + + + DS + S+ S+++ S+D DSS++SD + Sbjct: 799 NSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSDSSDSSDSSDGS 851 Score = 28.9 bits (63), Expect = 4.0 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDS-----KDLSEVSETTESTDVKDSSEASD 232 N +S +S S + + G DS D S S++++S+D +SS++SD Sbjct: 822 NSSDSSNSSDSSDSSNSSDSSDSSDSSDGSDSDSSNRSDSSNSSDSSDSSDSSNSSDSSD 881 Query: 233 SA 234 S+ Sbjct: 882 SS 883 Score = 28.9 bits (63), Expect = 4.0 Identities = 14/55 (25%), Positives = 28/55 (50%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S + + D+ + S+ S +++S+D DSS +SDS++ Sbjct: 904 DSSDSSNSSDSSDSSNSSDSSESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDSSN 958 Score = 28.5 bits (62), Expect = 5.2 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 S N+ S+G DSG D S+ S++++S++ DSS++SDS S Sbjct: 519 SDTNNSDSNGNGNNGNDDNDKSDSGKGKSDSSD-SDSSDSSNSSDSSDSSDSDS 571 Score = 28.5 bits (62), Expect = 5.2 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 16/74 (21%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSG-GDSKDLSEVSETTESTDV------------ 224 N +S GN + + + + G DS DS D S S++++S+D Sbjct: 522 NNSDSNGNGNNGNDDNDKSDSGKGKSDSSDSDSSDSSNSSDSSDSSDSDSSDSNSSSDSD 581 Query: 225 ---KDSSEASDSAS 235 DSS++SDS S Sbjct: 582 SSDSDSSDSSDSDS 595 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/54 (25%), Positives = 28/54 (51%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S +S S + + DS + S+ S +++S+D +SS++SDS+ Sbjct: 694 DSSNSSESSDSSDSSDSDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSS 747 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/55 (23%), Positives = 29/55 (52%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 +S +S S + +S D S+ S++++S+D +SS+++DS++ Sbjct: 736 DSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSN 790 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/54 (25%), Positives = 27/54 (50%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 S +S S + + DS + S+ ++++ S+D DSS +SDS++ Sbjct: 752 SSDSSDSSDSSNSSDSSDSSDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSN 805 Score = 28.1 bits (61), Expect = 6.8 Identities = 13/54 (24%), Positives = 30/54 (55%) Query: 182 SKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 + +S SS + + + +S D S+ S+++ S+D DSS++++S++ Sbjct: 837 NSSDSSDSSDSSDGSDSDSSNRSDSSNSSDSSDSSDSSNSSDSSDSSDSNESSN 890 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/50 (28%), Positives = 27/50 (54%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSA 234 +S SS + ++ S + S+ S+++ S+D DSS++SDS+ Sbjct: 946 DSSDSSNSSDSSNSSDSSNSSDSSDSNSSDSSDSSNSSDSSDSSDSSDSS 995 Score = 28.1 bits (61), Expect = 6.8 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTD-VKDSSEASDSAS 235 +S +S S E + DS + S+ S++++S+D DS++ SDS S Sbjct: 1218 DSSDSSDSSDSSDSNESSDSSDSSDSSDSSNSSDSSDSSDSSDSTSDSNDESDSQS 1273 Score = 27.7 bits (60), Expect = 8.9 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 N +S +S S + DS D S+ S+++ S+D +SS++SDS++ Sbjct: 781 NSSDSNDSSNSSDSSDSSNSSDSSNSSDSSDSSDSSD-SDSSNSSDSSNSSDSSDSSN 837 Score = 27.7 bits (60), Expect = 8.9 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Query: 185 NSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 NS SS + + +++ S G D S S+++ S+D SS++SDS++ Sbjct: 828 NSSDSSDSSNSSDSSDSSDSSDGSDSDSSNRSDSSNSSD---SSDSSDSSN 875 Score = 27.7 bits (60), Expect = 8.9 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query: 178 NKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS 235 N +S +S S+ + + DS D S S++ +S+D +SS++SDS++ Sbjct: 863 NSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSSDSSNSSDS-DSSDSSNSSDSSDSSN 919 >gi|134254455 N-acetyltransferase 15 [Homo sapiens] Length = 242 Score = 34.3 bits (77), Expect = 0.095 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 22/115 (19%) Query: 44 IAEDENGKIVGYVLAKME-------EDPD--------DVPHGHITSLAVKRSHRRLG--- 85 +A G IVG ++A+++ ED D D +I SL V + R+ G Sbjct: 55 LAATYRGAIVGMIVAEIKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGS 114 Query: 86 -LAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYA 139 L + L D S ++ A Y LHV +N A++ Y N +F+ P YY+ Sbjct: 115 LLLESLKDHISTTAQDHCKAIY--LHVLTTNNTAINFYENR-DFKQHHYLPYYYS 166 >gi|134254440 N-acetyltransferase 15 [Homo sapiens] Length = 242 Score = 34.3 bits (77), Expect = 0.095 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 22/115 (19%) Query: 44 IAEDENGKIVGYVLAKME-------EDPD--------DVPHGHITSLAVKRSHRRLG--- 85 +A G IVG ++A+++ ED D D +I SL V + R+ G Sbjct: 55 LAATYRGAIVGMIVAEIKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGS 114 Query: 86 -LAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYA 139 L + L D S ++ A Y LHV +N A++ Y N +F+ P YY+ Sbjct: 115 LLLESLKDHISTTAQDHCKAIY--LHVLTTNNTAINFYENR-DFKQHHYLPYYYS 166 >gi|13376261 N-acetyltransferase 15 [Homo sapiens] Length = 242 Score = 34.3 bits (77), Expect = 0.095 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 22/115 (19%) Query: 44 IAEDENGKIVGYVLAKME-------EDPD--------DVPHGHITSLAVKRSHRRLG--- 85 +A G IVG ++A+++ ED D D +I SL V + R+ G Sbjct: 55 LAATYRGAIVGMIVAEIKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGS 114 Query: 86 -LAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYA 139 L + L D S ++ A Y LHV +N A++ Y N +F+ P YY+ Sbjct: 115 LLLESLKDHISTTAQDHCKAIY--LHVLTTNNTAINFYENR-DFKQHHYLPYYYS 166 >gi|55749769 CWC22 spliceosome-associated protein homolog [Homo sapiens] Length = 908 Score = 34.3 bits (77), Expect = 0.095 Identities = 30/82 (36%), Positives = 38/82 (46%), Gaps = 15/82 (18%) Query: 154 MADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLS 213 + DELR HL+ K V+ A + VE +SP SS A + + DS DS D S Sbjct: 639 LTDELREHLKNTPK----VIVAQKPDVEQNKSSPSSSSSASSSSES-DSSDSDSDSSDSS 693 Query: 214 EVSETTESTDVKDSSEASDSAS 235 S SSE SDS+S Sbjct: 694 SES----------SSEESDSSS 705 >gi|117190254 heterogeneous nuclear ribonucleoprotein C isoform b [Homo sapiens] Length = 293 Score = 33.1 bits (74), Expect = 0.21 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 7/92 (7%) Query: 141 GEDAYAMKRDLTQM---ADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREE 197 G+D A+K++LTQ+ D L +LE EK + A+E K K SS ++E Sbjct: 177 GDDLQAIKKELTQIKQKVDSLLENLEKIEKEQS--KQAVEMK-NDKSEEEQSSSSVKKDE 233 Query: 198 KGLAAEDSGGDSKDLSEVSETTESTDVKDSSE 229 + E GG + D +E + + D +D + Sbjct: 234 TNVKMESEGG-ADDSAEEGDLLDDDDNEDRGD 264 >gi|117190192 heterogeneous nuclear ribonucleoprotein C isoform a [Homo sapiens] Length = 306 Score = 33.1 bits (74), Expect = 0.21 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 7/92 (7%) Query: 141 GEDAYAMKRDLTQM---ADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREE 197 G+D A+K++LTQ+ D L +LE EK + A+E K K SS ++E Sbjct: 190 GDDLQAIKKELTQIKQKVDSLLENLEKIEKEQS--KQAVEMK-NDKSEEEQSSSSVKKDE 246 Query: 198 KGLAAEDSGGDSKDLSEVSETTESTDVKDSSE 229 + E GG + D +E + + D +D + Sbjct: 247 TNVKMESEGG-ADDSAEEGDLLDDDDNEDRGD 277 >gi|117190174 heterogeneous nuclear ribonucleoprotein C isoform b [Homo sapiens] Length = 293 Score = 33.1 bits (74), Expect = 0.21 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 7/92 (7%) Query: 141 GEDAYAMKRDLTQM---ADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREE 197 G+D A+K++LTQ+ D L +LE EK + A+E K K SS ++E Sbjct: 177 GDDLQAIKKELTQIKQKVDSLLENLEKIEKEQS--KQAVEMK-NDKSEEEQSSSSVKKDE 233 Query: 198 KGLAAEDSGGDSKDLSEVSETTESTDVKDSSE 229 + E GG + D +E + + D +D + Sbjct: 234 TNVKMESEGG-ADDSAEEGDLLDDDDNEDRGD 264 >gi|117189975 heterogeneous nuclear ribonucleoprotein C isoform a [Homo sapiens] Length = 306 Score = 33.1 bits (74), Expect = 0.21 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 7/92 (7%) Query: 141 GEDAYAMKRDLTQM---ADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREE 197 G+D A+K++LTQ+ D L +LE EK + A+E K K SS ++E Sbjct: 190 GDDLQAIKKELTQIKQKVDSLLENLEKIEKEQS--KQAVEMK-NDKSEEEQSSSSVKKDE 246 Query: 198 KGLAAEDSGGDSKDLSEVSETTESTDVKDSSE 229 + E GG + D +E + + D +D + Sbjct: 247 TNVKMESEGG-ADDSAEEGDLLDDDDNEDRGD 277 >gi|21735415 centromere protein B [Homo sapiens] Length = 599 Score = 32.7 bits (73), Expect = 0.28 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Query: 174 GAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDV-KDSSEASD 232 G E + E + GE EE+G E+ GG+ ++L E E E DV D E D Sbjct: 405 GEEEEEEEEEEEEEEGEGEE-EEEEGEEEEEEGGEGEELGEEEEVEEEGDVDSDEEEEED 463 Query: 233 SAS 235 S Sbjct: 464 EES 466 >gi|156104891 general transcription factor IIF, polypeptide 1, 74kDa [Homo sapiens] Length = 517 Score = 32.7 bits (73), Expect = 0.28 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 11/107 (10%) Query: 127 NFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNS 186 +F+ EV+ Y +DG + +Q E + +E+G V ++ ES+ Sbjct: 265 DFEGQEVD--YMSDGSSS-------SQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEK 315 Query: 187 PPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDS 233 PP + EEK KD SE S+++E +D+ SEAS + Sbjct: 316 PPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDI--DSEASSA 360 >gi|211971067 heterogeneous nuclear ribonucleoprotein C-like [Homo sapiens] Length = 293 Score = 32.7 bits (73), Expect = 0.28 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 7/92 (7%) Query: 141 GEDAYAMKRDLTQM---ADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREE 197 G+D A+K++LTQ+ D L +LE EK + ++N +K SS ++E Sbjct: 177 GDDLQAIKQELTQIKQKVDSLLENLEKIEKEQSKQEVEVKN---AKSEEEQSSSSMKKDE 233 Query: 198 KGLAAEDSGGDSKDLSEVSETTESTDVKDSSE 229 + E GG ++D +E + + D +D + Sbjct: 234 THVKMESEGG-AEDSAEEGDPLDDDDNEDQGD 264 >gi|148368962 NKF3 kinase family member [Homo sapiens] Length = 1746 Score = 32.7 bits (73), Expect = 0.28 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 15/76 (19%) Query: 174 GAIENKVESKGNSPPSS-GEACREE----------KGLAAEDSGGDSKDLSEVSETTES- 221 G+I++ V S SP SS E R E G + + GDSKD+ E+ ES Sbjct: 331 GSIQSMVSSDSTSPDSSLTEESRSETASSLSQKICNGGLSPGNPGDSKDMKEIEPNYESP 390 Query: 222 ---TDVKDSSEASDSA 234 KDSS+AS S+ Sbjct: 391 SSNNQDKDSSQASKSS 406 >gi|5453567 craniofacial development protein 1 [Homo sapiens] Length = 299 Score = 32.3 bits (72), Expect = 0.36 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 9/64 (14%) Query: 181 ESKGNSPPSSGEACREEKGLAAEDSGGDSKD------LSEV---SETTESTDVKDSSEAS 231 ES+G+S +A +EKG+ +ED+ +D L++V S+ ST VK E Sbjct: 81 ESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETE 140 Query: 232 DSAS 235 +++S Sbjct: 141 ETSS 144 >gi|5032281 dystrophin Dp427c isoform [Homo sapiens] Length = 3677 Score = 32.0 bits (71), Expect = 0.47 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 17/97 (17%) Query: 90 LMDQASRAMIENFNAKYVSLH---VRK------------SNRAALHLYSNTLNFQISEVE 134 +MD+ +E FN+++ LH VR+ +LHL +L F I + Sbjct: 1327 VMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQESLTF-IDKQL 1385 Query: 135 PKYYADGEDAYAMKRDLTQMADELRRH-LELKEKGRH 170 Y AD DA M ++ ++ +L H + L+E +H Sbjct: 1386 AAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKH 1422 >gi|5032315 dystrophin Dp427p2 isoform [Homo sapiens] Length = 3562 Score = 32.0 bits (71), Expect = 0.47 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 17/97 (17%) Query: 90 LMDQASRAMIENFNAKYVSLH---VRK------------SNRAALHLYSNTLNFQISEVE 134 +MD+ +E FN+++ LH VR+ +LHL +L F I + Sbjct: 1212 VMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQESLTF-IDKQL 1270 Query: 135 PKYYADGEDAYAMKRDLTQMADELRRH-LELKEKGRH 170 Y AD DA M ++ ++ +L H + L+E +H Sbjct: 1271 AAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKH 1307 >gi|5032287 dystrophin Dp427p1 isoform [Homo sapiens] Length = 3681 Score = 32.0 bits (71), Expect = 0.47 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 17/97 (17%) Query: 90 LMDQASRAMIENFNAKYVSLH---VRK------------SNRAALHLYSNTLNFQISEVE 134 +MD+ +E FN+++ LH VR+ +LHL +L F I + Sbjct: 1331 VMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQESLTF-IDKQL 1389 Query: 135 PKYYADGEDAYAMKRDLTQMADELRRH-LELKEKGRH 170 Y AD DA M ++ ++ +L H + L+E +H Sbjct: 1390 AAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKH 1426 >gi|5032285 dystrophin Dp427l isoform [Homo sapiens] Length = 3562 Score = 32.0 bits (71), Expect = 0.47 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 17/97 (17%) Query: 90 LMDQASRAMIENFNAKYVSLH---VRK------------SNRAALHLYSNTLNFQISEVE 134 +MD+ +E FN+++ LH VR+ +LHL +L F I + Sbjct: 1212 VMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQESLTF-IDKQL 1270 Query: 135 PKYYADGEDAYAMKRDLTQMADELRRH-LELKEKGRH 170 Y AD DA M ++ ++ +L H + L+E +H Sbjct: 1271 AAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKH 1307 >gi|5032283 dystrophin Dp427m isoform [Homo sapiens] Length = 3685 Score = 32.0 bits (71), Expect = 0.47 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 17/97 (17%) Query: 90 LMDQASRAMIENFNAKYVSLH---VRK------------SNRAALHLYSNTLNFQISEVE 134 +MD+ +E FN+++ LH VR+ +LHL +L F I + Sbjct: 1335 VMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQESLTF-IDKQL 1393 Query: 135 PKYYADGEDAYAMKRDLTQMADELRRH-LELKEKGRH 170 Y AD DA M ++ ++ +L H + L+E +H Sbjct: 1394 AAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKH 1430 >gi|4759128 solute carrier family 24 (sodium/potassium/calcium exchanger), member 1 [Homo sapiens] Length = 1099 Score = 31.6 bits (70), Expect = 0.62 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query: 177 ENKVESKGNSPPSSGEACREEKGL--AAEDSGGDSKDLSEVSETTESTDVKDSSEASD 232 E + ES+ S + GEA +EKG+ GGDS++ E E E + ++ E + Sbjct: 825 EGETESQELSAENHGEAKNDEKGVEDGGGSDGGDSEEEEEEEEEQEEEEEEEEQEEEE 882 >gi|30581135 structural maintenance of chromosomes 1A [Homo sapiens] Length = 1233 Score = 31.2 bits (69), Expect = 0.81 Identities = 34/157 (21%), Positives = 66/157 (42%), Gaps = 11/157 (7%) Query: 59 KMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAA 118 +++ED D V H+ VK+ + +KL + R M + + L K+ A Sbjct: 827 QLKEDQDKV---HMWEQTVKKDENEI---EKLKKEEQRHM-KIIDETMAQLQDLKNQHLA 879 Query: 119 LHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIEN 178 N N ++ E+ K ++ +++++T + +L E K RH +L A + Sbjct: 880 KKSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKL----EQKRSDRHNLLQACKM 935 Query: 179 KVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEV 215 + S + + +EE EDS S+ +S + Sbjct: 936 QDIKLPLSKGTMDDISQEEGSSQGEDSVSGSQRISSI 972 >gi|14195601 protein phosphatase 1, regulatory (inhibitor) subunit 12B isoform b [Homo sapiens] Length = 998 Score = 31.2 bits (69), Expect = 0.81 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Query: 154 MADE-LRRHLELKEKGRHVVLGAIENK---VESKGNSPPSSGEACREEKGLAAEDS--GG 207 +ADE L HLEL +K ++V+ E + +ES NS SG +EK L E++ Sbjct: 289 VADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQ 348 Query: 208 DSKDLSEVSETTESTDVKDSSEASDS 233 + ++ ++ S ++ S + + EAS+S Sbjct: 349 EMEEENKESSSSSSEEEEGEDEASES 374 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.311 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,794,113 Number of Sequences: 37866 Number of extensions: 378707 Number of successful extensions: 1377 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 71 Number of HSP's that attempted gapping in prelim test: 1160 Number of HSP's gapped (non-prelim): 255 length of query: 235 length of database: 18,247,518 effective HSP length: 99 effective length of query: 136 effective length of database: 14,498,784 effective search space: 1971834624 effective search space used: 1971834624 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 60 (27.7 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.