BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|169212891 PREDICTED: similar to hCG1644617 [Homo sapiens] (95 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|169212891 PREDICTED: similar to hCG1644617 [Homo sapiens] 197 1e-51 gi|239751495 PREDICTED: similar to hCG1644617 [Homo sapiens] 197 1e-51 gi|239745993 PREDICTED: hypothetical protein LOC441806 [Homo sap... 195 6e-51 gi|156631005 proteasome 26S non-ATPase subunit 8 [Homo sapiens] 146 4e-36 gi|67551265 transcription factor ELYS [Homo sapiens] 26 6.0 >gi|169212891 PREDICTED: similar to hCG1644617 [Homo sapiens] Length = 95 Score = 197 bits (502), Expect = 1e-51 Identities = 95/95 (100%), Positives = 95/95 (100%) Query: 1 MELEWLPATDTQTNAYIKRPVSLEPYLKEGGYNKVFLAKGNIPAKSYTFIHILLDTIRDE 60 MELEWLPATDTQTNAYIKRPVSLEPYLKEGGYNKVFLAKGNIPAKSYTFIHILLDTIRDE Sbjct: 1 MELEWLPATDTQTNAYIKRPVSLEPYLKEGGYNKVFLAKGNIPAKSYTFIHILLDTIRDE 60 Query: 61 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK 95 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK Sbjct: 61 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK 95 >gi|239751495 PREDICTED: similar to hCG1644617 [Homo sapiens] Length = 95 Score = 197 bits (502), Expect = 1e-51 Identities = 95/95 (100%), Positives = 95/95 (100%) Query: 1 MELEWLPATDTQTNAYIKRPVSLEPYLKEGGYNKVFLAKGNIPAKSYTFIHILLDTIRDE 60 MELEWLPATDTQTNAYIKRPVSLEPYLKEGGYNKVFLAKGNIPAKSYTFIHILLDTIRDE Sbjct: 1 MELEWLPATDTQTNAYIKRPVSLEPYLKEGGYNKVFLAKGNIPAKSYTFIHILLDTIRDE 60 Query: 61 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK 95 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK Sbjct: 61 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK 95 >gi|239745993 PREDICTED: hypothetical protein LOC441806 [Homo sapiens] Length = 95 Score = 195 bits (496), Expect = 6e-51 Identities = 94/95 (98%), Positives = 94/95 (98%) Query: 1 MELEWLPATDTQTNAYIKRPVSLEPYLKEGGYNKVFLAKGNIPAKSYTFIHILLDTIRDE 60 MELEWLPATDTQTNAYIKRPVSLEPYL EGGYNKVFLAKGNIPAKSYTFIHILLDTIRDE Sbjct: 1 MELEWLPATDTQTNAYIKRPVSLEPYLMEGGYNKVFLAKGNIPAKSYTFIHILLDTIRDE 60 Query: 61 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK 95 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK Sbjct: 61 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK 95 >gi|156631005 proteasome 26S non-ATPase subunit 8 [Homo sapiens] Length = 350 Score = 146 bits (368), Expect = 4e-36 Identities = 76/95 (80%), Positives = 80/95 (84%), Gaps = 1/95 (1%) Query: 2 ELEWLPATDTQTNAYIKRPVSLEPYLKEGGYNKVFLAKGNIPAKSYT-FIHILLDTIRDE 60 ELE LPA D QTN YIK PVSLE YL EG YNKVFLAKGNIPA+SYT FI ILLDTIRDE Sbjct: 211 ELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDE 270 Query: 61 MAGCIEKAYEKILFTKATWILFLNTPKQMMDNTKK 95 +AGCIEKAYEKILFT+AT ILF NTPK+M D KK Sbjct: 271 IAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKK 305 >gi|67551265 transcription factor ELYS [Homo sapiens] Length = 2266 Score = 26.2 bits (56), Expect = 6.0 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Query: 1 MELEWLPATDTQTNAYIKRPVSLEPYLKEGGYN--KVFLAKGN 41 +E EWL + D T+ ++ P + EG + K+ ++KGN Sbjct: 1265 VETEWLKSKDRTTSFFLNSPEKEHQEMDEGSQSLEKLDVSKGN 1307 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.319 0.135 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,484,294 Number of Sequences: 37866 Number of extensions: 121581 Number of successful extensions: 177 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 172 Number of HSP's gapped (non-prelim): 5 length of query: 95 length of database: 18,247,518 effective HSP length: 66 effective length of query: 29 effective length of database: 15,748,362 effective search space: 456702498 effective search space used: 456702498 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.