BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|58331207 retinoid X receptor, gamma isoform b [Homo sapiens] (33 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|58331207 retinoid X receptor, gamma isoform b [Homo sapiens] 73 5e-14 gi|5902068 retinoid X receptor, gamma isoform a [Homo sapiens] 44 3e-05 >gi|58331207 retinoid X receptor, gamma isoform b [Homo sapiens] Length = 33 Score = 72.8 bits (177), Expect = 5e-14 Identities = 33/33 (100%), Positives = 33/33 (100%) Query: 1 MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLGL 33 MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLGL Sbjct: 1 MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLGL 33 >gi|5902068 retinoid X receptor, gamma isoform a [Homo sapiens] Length = 463 Score = 43.9 bits (102), Expect = 3e-05 Identities = 20/33 (60%), Positives = 21/33 (63%) Query: 1 MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLGL 33 MYGNYSHFMKFPAGYGG +S S L Sbjct: 1 MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAAL 33 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,387,368 Number of Sequences: 37866 Number of extensions: 27229 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 81 Number of HSP's gapped (non-prelim): 2 length of query: 33 length of database: 18,247,518 effective HSP length: 8 effective length of query: 25 effective length of database: 17,944,590 effective search space: 448614750 effective search space used: 448614750 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.