BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|55956781 sterol carrier protein 2 isoform 3 precursor [Homo sapiens] (59 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|55956781 sterol carrier protein 2 isoform 3 precursor [Homo s... 119 4e-28 gi|19923233 sterol carrier protein 2 isoform 1 proprotein [Homo ... 85 1e-17 gi|55956777 sterol carrier protein 2 isoform 1 precursor [Homo s... 85 1e-17 gi|55956779 sterol carrier protein 2 isoform 2 precursor [Homo s... 74 2e-14 gi|116734710 ATP-binding cassette, sub-family A member 3 [Homo s... 27 3.5 gi|22208850 Golgi coiled-coil protein 1 [Homo sapiens] 27 4.6 gi|178557813 hypothetical protein LOC644186 [Homo sapiens] 26 7.9 gi|4505727 peroxisomal biogenesis factor 3 [Homo sapiens] 26 7.9 >gi|55956781 sterol carrier protein 2 isoform 3 precursor [Homo sapiens] Length = 59 Score = 119 bits (299), Expect = 4e-28 Identities = 59/59 (100%), Positives = 59/59 (100%) Query: 1 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEIRRLTAQSQWLTQTSWL 59 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEIRRLTAQSQWLTQTSWL Sbjct: 1 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEIRRLTAQSQWLTQTSWL 59 >gi|19923233 sterol carrier protein 2 isoform 1 proprotein [Homo sapiens] Length = 547 Score = 85.1 bits (209), Expect = 1e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Query: 1 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEE 42 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEE Sbjct: 405 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEE 446 >gi|55956777 sterol carrier protein 2 isoform 1 precursor [Homo sapiens] Length = 143 Score = 85.1 bits (209), Expect = 1e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Query: 1 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEE 42 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEE Sbjct: 1 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEE 42 >gi|55956779 sterol carrier protein 2 isoform 2 precursor [Homo sapiens] Length = 140 Score = 74.3 bits (181), Expect = 2e-14 Identities = 39/42 (92%), Positives = 39/42 (92%), Gaps = 3/42 (7%) Query: 1 MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEE 42 MGFPEAA RTHQIEAVPTSSASDGFKANLVFKEIEKKLEE Sbjct: 1 MGFPEAA---RTHQIEAVPTSSASDGFKANLVFKEIEKKLEE 39 >gi|116734710 ATP-binding cassette, sub-family A member 3 [Homo sapiens] Length = 1704 Score = 26.9 bits (58), Expect = 3.5 Identities = 11/30 (36%), Positives = 18/30 (60%) Query: 29 ANLVFKEIEKKLEEIRRLTAQSQWLTQTSW 58 A V +E E++L+E R+ S WL ++W Sbjct: 279 ARAVVQEKERRLKEYMRMMGLSSWLHWSAW 308 >gi|22208850 Golgi coiled-coil protein 1 [Homo sapiens] Length = 775 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Query: 15 IEAVPTSSASDGFKANLVF--KEIEKKLEEIRRLTAQSQ 51 +E +P+S A+DG KA ++ +E+++ EE R ++Q Sbjct: 462 LEIMPSSEAADGEKATALYYQQELKQLKEEFERYKMRAQ 500 >gi|178557813 hypothetical protein LOC644186 [Homo sapiens] Length = 88 Score = 25.8 bits (55), Expect = 7.9 Identities = 8/20 (40%), Positives = 16/20 (80%) Query: 34 KEIEKKLEEIRRLTAQSQWL 53 K++EK LEE+ +++ Q+ W+ Sbjct: 23 KDLEKLLEEMEKISVQATWM 42 >gi|4505727 peroxisomal biogenesis factor 3 [Homo sapiens] Length = 373 Score = 25.8 bits (55), Expect = 7.9 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Query: 16 EAVPTSSASDGFKANLVFKEIEKKLEEIRRLTAQ---SQWLTQ 55 +AV S K +L ++E+KL+EIR L Q S W+ + Sbjct: 185 QAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINK 227 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.314 0.124 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,005,147 Number of Sequences: 37866 Number of extensions: 52585 Number of successful extensions: 214 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 208 Number of HSP's gapped (non-prelim): 8 length of query: 59 length of database: 18,247,518 effective HSP length: 32 effective length of query: 27 effective length of database: 17,035,806 effective search space: 459966762 effective search space used: 459966762 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.