BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|239748155 PREDICTED: hypothetical protein XP_002346540 [Homo sapiens] (43 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|239753510 PREDICTED: hypothetical protein [Homo sapiens] 94 2e-20 gi|239748155 PREDICTED: hypothetical protein XP_002346540 [Homo ... 94 2e-20 gi|239742053 PREDICTED: hypothetical protein XP_002342380 [Homo ... 94 2e-20 >gi|239753510 PREDICTED: hypothetical protein [Homo sapiens] Length = 284 Score = 94.0 bits (232), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MSMMVLGLSRRKTMGHANLGGIKATWACQKSQSQSPPPGRHRP 43 MSMMVLGLSRRKTMGHANLGGIKATWACQKSQSQSPPPGRHRP Sbjct: 242 MSMMVLGLSRRKTMGHANLGGIKATWACQKSQSQSPPPGRHRP 284 >gi|239748155 PREDICTED: hypothetical protein XP_002346540 [Homo sapiens] Length = 43 Score = 94.0 bits (232), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MSMMVLGLSRRKTMGHANLGGIKATWACQKSQSQSPPPGRHRP 43 MSMMVLGLSRRKTMGHANLGGIKATWACQKSQSQSPPPGRHRP Sbjct: 1 MSMMVLGLSRRKTMGHANLGGIKATWACQKSQSQSPPPGRHRP 43 >gi|239742053 PREDICTED: hypothetical protein XP_002342380 [Homo sapiens] Length = 311 Score = 94.0 bits (232), Expect = 2e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MSMMVLGLSRRKTMGHANLGGIKATWACQKSQSQSPPPGRHRP 43 MSMMVLGLSRRKTMGHANLGGIKATWACQKSQSQSPPPGRHRP Sbjct: 269 MSMMVLGLSRRKTMGHANLGGIKATWACQKSQSQSPPPGRHRP 311 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.318 0.128 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,027,370 Number of Sequences: 37866 Number of extensions: 50420 Number of successful extensions: 202 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 199 Number of HSP's gapped (non-prelim): 3 length of query: 43 length of database: 18,247,518 effective HSP length: 17 effective length of query: 26 effective length of database: 17,603,796 effective search space: 457698696 effective search space used: 457698696 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.