BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|239744205 PREDICTED: hypothetical protein XP_002343055 [Homo sapiens] (123 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|239755407 PREDICTED: hypothetical protein [Homo sapiens] 263 2e-71 gi|239749905 PREDICTED: hypothetical protein XP_002347200 [Homo ... 263 2e-71 gi|239744205 PREDICTED: hypothetical protein XP_002343055 [Homo ... 263 2e-71 gi|30725877 G protein-coupled receptor 180 precursor [Homo sapiens] 30 0.60 gi|13324688 bromodomain and WD repeat domain containing 2 [Homo ... 26 8.7 >gi|239755407 PREDICTED: hypothetical protein [Homo sapiens] Length = 123 Score = 263 bits (673), Expect = 2e-71 Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MSSGGSPGCLRLAEGCPNHRAWVRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESEN 60 MSSGGSPGCLRLAEGCPNHRAWVRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESEN Sbjct: 1 MSSGGSPGCLRLAEGCPNHRAWVRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESEN 60 Query: 61 PRHLLWNVCLVVLVCPSSSLACRFQVYQRTFCSVESHRTKRKILQLFANILPYLYKQPYT 120 PRHLLWNVCLVVLVCPSSSLACRFQVYQRTFCSVESHRTKRKILQLFANILPYLYKQPYT Sbjct: 61 PRHLLWNVCLVVLVCPSSSLACRFQVYQRTFCSVESHRTKRKILQLFANILPYLYKQPYT 120 Query: 121 KKH 123 KKH Sbjct: 121 KKH 123 >gi|239749905 PREDICTED: hypothetical protein XP_002347200 [Homo sapiens] Length = 123 Score = 263 bits (673), Expect = 2e-71 Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MSSGGSPGCLRLAEGCPNHRAWVRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESEN 60 MSSGGSPGCLRLAEGCPNHRAWVRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESEN Sbjct: 1 MSSGGSPGCLRLAEGCPNHRAWVRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESEN 60 Query: 61 PRHLLWNVCLVVLVCPSSSLACRFQVYQRTFCSVESHRTKRKILQLFANILPYLYKQPYT 120 PRHLLWNVCLVVLVCPSSSLACRFQVYQRTFCSVESHRTKRKILQLFANILPYLYKQPYT Sbjct: 61 PRHLLWNVCLVVLVCPSSSLACRFQVYQRTFCSVESHRTKRKILQLFANILPYLYKQPYT 120 Query: 121 KKH 123 KKH Sbjct: 121 KKH 123 >gi|239744205 PREDICTED: hypothetical protein XP_002343055 [Homo sapiens] Length = 123 Score = 263 bits (673), Expect = 2e-71 Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MSSGGSPGCLRLAEGCPNHRAWVRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESEN 60 MSSGGSPGCLRLAEGCPNHRAWVRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESEN Sbjct: 1 MSSGGSPGCLRLAEGCPNHRAWVRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESEN 60 Query: 61 PRHLLWNVCLVVLVCPSSSLACRFQVYQRTFCSVESHRTKRKILQLFANILPYLYKQPYT 120 PRHLLWNVCLVVLVCPSSSLACRFQVYQRTFCSVESHRTKRKILQLFANILPYLYKQPYT Sbjct: 61 PRHLLWNVCLVVLVCPSSSLACRFQVYQRTFCSVESHRTKRKILQLFANILPYLYKQPYT 120 Query: 121 KKH 123 KKH Sbjct: 121 KKH 123 >gi|30725877 G protein-coupled receptor 180 precursor [Homo sapiens] Length = 440 Score = 29.6 bits (65), Expect = 0.60 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 5/87 (5%) Query: 23 VRWNRRQPHSAFLIASHLFLSVLVWFNSFQGLELESENPRHLLWNVCLVVL-VCPSSSLA 81 ++W+ + + + SVL+ + F+ + S + H L + L+VL +C + SL Sbjct: 279 LQWDSTPASTGIAVFIVMTQSVLLLWEQFEDISHHSYHSHHNLAGILLIVLRICLALSLG 338 Query: 82 CRFQVYQRTFCSVESHRTKRKILQLFA 108 C +YQ +VE KR+ FA Sbjct: 339 C--GLYQ--IITVERSTLKREFYITFA 361 >gi|13324688 bromodomain and WD repeat domain containing 2 [Homo sapiens] Length = 1224 Score = 25.8 bits (55), Expect = 8.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 11 RLAEGCPNHRAWVRWNRRQP 30 R++ G P HR+WVR R P Sbjct: 740 RVSRGIPTHRSWVRKIRFAP 759 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.327 0.137 0.465 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,301,363 Number of Sequences: 37866 Number of extensions: 205990 Number of successful extensions: 492 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 487 Number of HSP's gapped (non-prelim): 6 length of query: 123 length of database: 18,247,518 effective HSP length: 89 effective length of query: 34 effective length of database: 14,877,444 effective search space: 505833096 effective search space used: 505833096 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.