BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|209862815 FXYD domain containing ion transport regulator 3 isoform 5 precursor [Homo sapiens] (61 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|209862815 FXYD domain containing ion transport regulator 3 is... 135 7e-33 gi|209862813 FXYD domain containing ion transport regulator 3 is... 135 7e-33 gi|209862819 FXYD domain containing ion transport regulator 3 is... 69 1e-12 gi|209862817 FXYD domain containing ion transport regulator 3 is... 69 1e-12 gi|209862811 FXYD domain containing ion transport regulator 3 is... 69 1e-12 gi|209862809 FXYD domain containing ion transport regulator 3 is... 69 1e-12 gi|11612674 FXYD domain containing ion transport regulator 3 iso... 69 1e-12 gi|5174635 FXYD domain containing ion transport regulator 3 isof... 69 1e-12 gi|27764904 FXYD domain containing ion transport regulator 4 [Ho... 33 0.038 gi|239756603 PREDICTED: hypothetical protein [Homo sapiens] 27 3.5 gi|90193619 nuclear matrix transcription factor 4 isoform c [Hom... 27 4.6 gi|90193617 nuclear matrix transcription factor 4 isoform b [Hom... 27 4.6 gi|90193615 nuclear matrix transcription factor 4 isoform b [Hom... 27 4.6 gi|90193613 nuclear matrix transcription factor 4 isoform a [Hom... 27 4.6 gi|90193611 nuclear matrix transcription factor 4 isoform a [Hom... 27 4.6 gi|36054194 nuclear matrix transcription factor 4 isoform a [Hom... 27 4.6 gi|209180475 nuclear matrix transcription factor 4 isoform d [Ho... 27 4.6 gi|148539835 dystroglycan 1 preproprotein [Homo sapiens] 26 6.0 gi|110347437 latent transforming growth factor beta binding prot... 26 6.0 gi|110347412 latent transforming growth factor beta binding prot... 26 6.0 gi|110347431 latent transforming growth factor beta binding prot... 26 6.0 gi|133922590 alcohol dehydrogenase, iron containing, 1 [Homo sap... 26 7.9 >gi|209862815 FXYD domain containing ion transport regulator 3 isoform 5 precursor [Homo sapiens] Length = 61 Score = 135 bits (340), Expect = 7e-33 Identities = 61/61 (100%), Positives = 61/61 (100%) Query: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYGESPCPLSPPHNPTYCLVPRVPIQGWGL 60 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYGESPCPLSPPHNPTYCLVPRVPIQGWGL Sbjct: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYGESPCPLSPPHNPTYCLVPRVPIQGWGL 60 Query: 61 T 61 T Sbjct: 61 T 61 >gi|209862813 FXYD domain containing ion transport regulator 3 isoform 5 precursor [Homo sapiens] Length = 61 Score = 135 bits (340), Expect = 7e-33 Identities = 61/61 (100%), Positives = 61/61 (100%) Query: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYGESPCPLSPPHNPTYCLVPRVPIQGWGL 60 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYGESPCPLSPPHNPTYCLVPRVPIQGWGL Sbjct: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYGESPCPLSPPHNPTYCLVPRVPIQGWGL 60 Query: 61 T 61 T Sbjct: 61 T 61 >gi|209862819 FXYD domain containing ion transport regulator 3 isoform 2 precursor [Homo sapiens] Length = 113 Score = 68.6 bits (166), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY Sbjct: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 >gi|209862817 FXYD domain containing ion transport regulator 3 isoform 1 precursor [Homo sapiens] Length = 87 Score = 68.6 bits (166), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY Sbjct: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 >gi|209862811 FXYD domain containing ion transport regulator 3 isoform4 precursor [Homo sapiens] Length = 96 Score = 68.6 bits (166), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY Sbjct: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 >gi|209862809 FXYD domain containing ion transport regulator 3 isoform 3 [Homo sapiens] Length = 144 Score = 68.6 bits (166), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY Sbjct: 58 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 89 >gi|11612674 FXYD domain containing ion transport regulator 3 isoform 2 precursor [Homo sapiens] Length = 113 Score = 68.6 bits (166), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY Sbjct: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 >gi|5174635 FXYD domain containing ion transport regulator 3 isoform 1 precursor [Homo sapiens] Length = 87 Score = 68.6 bits (166), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY Sbjct: 1 MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYY 32 >gi|27764904 FXYD domain containing ion transport regulator 4 [Homo sapiens] Length = 89 Score = 33.5 bits (75), Expect = 0.038 Identities = 18/33 (54%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Query: 1 MQKVTLGLLVFLAGFPVLDAND-LEDKNSPFYY 32 M++VTL LL+ LAG L+AND +K+ PFYY Sbjct: 1 MERVTLALLL-LAGLTALEANDPFANKDDPFYY 32 >gi|239756603 PREDICTED: hypothetical protein [Homo sapiens] Length = 191 Score = 26.9 bits (58), Expect = 3.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Query: 36 PCPLSPPHNPTYCLVPRVPIQGWG 59 P P+ P+ CL P P+QGWG Sbjct: 49 PDPVRLTLFPSCCLRPPEPVQGWG 72 >gi|90193619 nuclear matrix transcription factor 4 isoform c [Homo sapiens] Length = 461 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Query: 21 NDLEDKNSPFYYGESPCPLSPPHNPTYCLVP 51 N ++D+ P E C L+PPH PT VP Sbjct: 30 NKMKDQLLP----EKGCGLAPPHYPTLLTVP 56 >gi|90193617 nuclear matrix transcription factor 4 isoform b [Homo sapiens] Length = 500 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Query: 21 NDLEDKNSPFYYGESPCPLSPPHNPTYCLVP 51 N ++D+ P E C L+PPH PT VP Sbjct: 30 NKMKDQLLP----EKGCGLAPPHYPTLLTVP 56 >gi|90193615 nuclear matrix transcription factor 4 isoform b [Homo sapiens] Length = 500 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Query: 21 NDLEDKNSPFYYGESPCPLSPPHNPTYCLVP 51 N ++D+ P E C L+PPH PT VP Sbjct: 30 NKMKDQLLP----EKGCGLAPPHYPTLLTVP 56 >gi|90193613 nuclear matrix transcription factor 4 isoform a [Homo sapiens] Length = 516 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Query: 21 NDLEDKNSPFYYGESPCPLSPPHNPTYCLVP 51 N ++D+ P E C L+PPH PT VP Sbjct: 30 NKMKDQLLP----EKGCGLAPPHYPTLLTVP 56 >gi|90193611 nuclear matrix transcription factor 4 isoform a [Homo sapiens] Length = 516 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Query: 21 NDLEDKNSPFYYGESPCPLSPPHNPTYCLVP 51 N ++D+ P E C L+PPH PT VP Sbjct: 30 NKMKDQLLP----EKGCGLAPPHYPTLLTVP 56 >gi|36054194 nuclear matrix transcription factor 4 isoform a [Homo sapiens] Length = 516 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Query: 21 NDLEDKNSPFYYGESPCPLSPPHNPTYCLVP 51 N ++D+ P E C L+PPH PT VP Sbjct: 30 NKMKDQLLP----EKGCGLAPPHYPTLLTVP 56 >gi|209180475 nuclear matrix transcription factor 4 isoform d [Homo sapiens] Length = 577 Score = 26.6 bits (57), Expect = 4.6 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Query: 21 NDLEDKNSPFYYGESPCPLSPPHNPTYCLVP 51 N ++D+ P E C L+PPH PT VP Sbjct: 30 NKMKDQLLP----EKGCGLAPPHYPTLLTVP 56 >gi|148539835 dystroglycan 1 preproprotein [Homo sapiens] Length = 895 Score = 26.2 bits (56), Expect = 6.0 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Query: 14 GFPVLDANDLEDK------NSPFYYGESPCPLSPPHNPTYCLVPRVPI 55 G P++ A++L+D + P E PL PP P + P+ Sbjct: 795 GVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPL 842 >gi|110347437 latent transforming growth factor beta binding protein 4 isoform c [Homo sapiens] Length = 1557 Score = 26.2 bits (56), Expect = 6.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Query: 14 GFPVLDANDLEDKNSPFYYGESPCPLSP 41 G P D D ED P+ E+P P P Sbjct: 1400 GAPRFDMPDFEDDGGPYGESEAPAPPGP 1427 >gi|110347412 latent transforming growth factor beta binding protein 4 isoform b [Homo sapiens] Length = 1587 Score = 26.2 bits (56), Expect = 6.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Query: 14 GFPVLDANDLEDKNSPFYYGESPCPLSP 41 G P D D ED P+ E+P P P Sbjct: 1430 GAPRFDMPDFEDDGGPYGESEAPAPPGP 1457 >gi|110347431 latent transforming growth factor beta binding protein 4 isoform a [Homo sapiens] Length = 1624 Score = 26.2 bits (56), Expect = 6.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Query: 14 GFPVLDANDLEDKNSPFYYGESPCPLSP 41 G P D D ED P+ E+P P P Sbjct: 1467 GAPRFDMPDFEDDGGPYGESEAPAPPGP 1494 >gi|133922590 alcohol dehydrogenase, iron containing, 1 [Homo sapiens] Length = 467 Score = 25.8 bits (55), Expect = 7.9 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 13 AGFPVLDANDLEDKNSPFYYGESPCPLSPPHNPTY 47 +GF VL + LE + Y+ SPCP +P P Y Sbjct: 239 SGFDVL-CHALESYTTLPYHLRSPCPSNPITRPAY 272 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.321 0.144 0.483 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,078,870 Number of Sequences: 37866 Number of extensions: 130651 Number of successful extensions: 457 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 438 Number of HSP's gapped (non-prelim): 22 length of query: 61 length of database: 18,247,518 effective HSP length: 34 effective length of query: 27 effective length of database: 16,960,074 effective search space: 457921998 effective search space used: 457921998 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.